SecReT4
Protein ID: 330827339
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4763
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]11074..11667 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDF4GGU1
KEGG IDadk:Alide2_4763
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 9.6e-30, Aligned region: 11..186
Protein Sequence: 197 a.a.     [Download]
>gi|330827339|ref|YP_004390577.1| hypothetical protein Alide2_4763 [Alicycliphilus denitrificans K601]
MAPDKAINERDKLQSQVRFHRAMNAGLLGTLFFGVLLLGFVVVRDTTKIVPPEVKRPYEIGSNYANKDYL
LDMAGYVLGTVLTVTPETVDYNNKVILKMADPDGYAGLKTALDAAAMRLKQERVTTIWVPRKEEVSEQDK
RVKVSGKLKTFIADKLTSEREKDYLVEFTITTSGRLYVSKIEEIVKRDPSANKPAGN
 
Nucleotide Sequence: 594 bp     [Download]
>gi|330827325|ref|NC_015423.1|:11074-11667 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGGCACCAGATAAAGCAATCAATGAGCGGGACAAGTTGCAATCGCAAGTCCGCTTCCACCGCGCGATGA
ACGCGGGCCTGCTGGGCACTCTGTTTTTCGGGGTGCTGCTGCTGGGCTTCGTCGTCGTGCGCGACACAAC
CAAGATCGTGCCGCCTGAAGTTAAGCGGCCCTACGAGATTGGATCGAACTACGCCAATAAGGACTACCTG
CTGGATATGGCCGGTTATGTCCTGGGCACGGTGTTGACCGTCACGCCGGAGACGGTTGATTACAACAACA
AGGTGATTCTCAAGATGGCCGACCCGGACGGCTACGCCGGGTTGAAGACCGCGCTTGATGCGGCCGCAAT
GCGGCTCAAACAGGAGCGAGTCACCACTATTTGGGTTCCTCGCAAAGAGGAAGTCAGCGAGCAGGACAAG
CGCGTGAAGGTCAGCGGAAAACTCAAGACCTTTATTGCCGACAAGCTCACTTCCGAACGCGAGAAGGACT
ATCTCGTTGAATTCACCATCACTACCTCGGGGCGTCTCTATGTTTCCAAGATCGAAGAAATCGTTAAGCG
CGATCCTTCTGCTAACAAGCCTGCTGGCAACTGA
 Primer design