SecReT4
Protein ID: 330827340
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4764
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]11777..12340 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDF4GGU2
KEGG IDadk:Alide2_4764
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 8.1e-37, Aligned region: 10..179
Protein Sequence: 187 a.a.     [Download]
>gi|330827340|ref|YP_004390578.1| hypothetical protein Alide2_4764 [Alicycliphilus denitrificans K601]
MVPSVKGVLAGQKDEALGAYYFTLASESPNQGTVTVFVSDEKGVTYKLILVPRPVAGEEIIIRPPSEKAT
PSSRAAADGRTVSYQRRIKDLMLVMADDELKDSVETIQVNKEVPLWKEGRLILVAKYMDGEVVGEKYRLT
NVSPSEMLLVEQELYRRGVRAIAVEHHTLMQGDGTDIYIVRERKDNE
 
Nucleotide Sequence: 564 bp     [Download]
>gi|330827325|ref|NC_015423.1|:11777-12340 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
GTGGTGCCCAGCGTGAAGGGCGTGCTGGCAGGCCAGAAGGACGAGGCCCTGGGGGCTTACTACTTCACGC
TGGCCAGCGAGTCGCCCAACCAGGGCACGGTCACGGTTTTCGTGTCCGACGAGAAGGGCGTTACCTACAA
GCTGATCCTCGTTCCGCGTCCGGTGGCCGGCGAGGAAATCATCATCCGGCCGCCGAGCGAGAAGGCTACG
CCTTCGAGCCGCGCAGCCGCTGATGGCCGCACCGTCTCCTACCAGCGCCGCATCAAGGACTTGATGCTGG
TGATGGCCGACGACGAGCTGAAGGACAGCGTTGAAACCATCCAGGTGAACAAGGAAGTGCCTTTGTGGAA
AGAGGGGCGCTTGATCTTGGTGGCCAAGTACATGGATGGCGAAGTGGTGGGCGAGAAATACCGCCTGACC
AACGTTTCCCCCTCCGAAATGCTGCTGGTCGAGCAGGAGCTTTACCGCCGTGGCGTGCGCGCCATTGCCG
TAGAGCACCACACGCTGATGCAGGGCGACGGGACGGACATCTACATCGTTCGGGAGCGCAAAGACAATGA
GTGA
 Primer design