SecReT4
Protein ID: 330827341
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4765
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]12333..13682 [+]
Productconjugation TrbI family protein
Component typeTraB_F
UniProt IDF4GGU3
KEGG IDadk:Alide2_4765
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.5e-40, Aligned region: 223..420
Protein Sequence: 449 a.a.     [Download]
>gi|330827341|ref|YP_004390579.1| conjugation TrbI family protein [Alicycliphilus denitrificans K601]
MSEPNAQTKKRQMMLIGGAVTGILGLAGAGMFLFDSGPAQHREKPKTVSITAPGTVDDKDAWRAQQAAKE
KSNEALIGEVKTQLKAQEEQNKKLAQALEELKANKAAAGSAGSATAAKPDASVLDKPLPIGNGTGPGQRV
LQSPNGKGGATTLNQPLNQVDVPARREVEIITFNNAEGKGAAGAAVGGAGGITEVLGFPTDEKAKKYGTT
SGGADGKKQTIEFLPAGSFVRVAMLNGVDAPTGGQAQSNPLPVAFHVLDVANLANKHKLDIKDCRIVAAT
WGDLSSERMMGRTETLACVINGEAVEMAIKGQVIGEDGKAGVRGRLVTKQGQLLANALFAGALSGIGKAF
QSSATITSTGGGGITQTIDPDKIGQAAIGGGVGSAGQQLAQYYLKAADKLYPVIETDGGRTVEILITKGA
VYSGKALAKDDYRGLLKRTGTNSRRYEDD
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|330827325|ref|NC_015423.1|:12333-13682 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGAGTGAGCCGAACGCACAAACAAAGAAACGCCAGATGATGCTCATCGGCGGGGCAGTGACCGGCATTC
TCGGTCTGGCCGGGGCTGGCATGTTCCTGTTCGACAGTGGCCCAGCACAGCACCGCGAAAAGCCCAAGAC
CGTCAGCATCACCGCACCGGGCACCGTAGATGACAAGGATGCGTGGCGTGCGCAGCAAGCGGCCAAGGAG
AAGTCCAACGAAGCCTTGATCGGGGAAGTTAAGACCCAGCTCAAGGCCCAGGAGGAACAGAACAAGAAGC
TCGCGCAGGCGCTGGAGGAACTGAAGGCCAACAAGGCCGCAGCCGGTTCGGCTGGCAGCGCAACGGCTGC
GAAGCCAGATGCTTCGGTTCTGGACAAGCCTTTGCCCATTGGCAACGGCACCGGGCCGGGCCAGCGTGTT
CTCCAGTCACCGAACGGCAAGGGCGGGGCCACCACCCTAAACCAGCCGCTCAATCAGGTGGATGTGCCGG
CGCGGCGGGAAGTGGAAATCATCACCTTCAACAATGCCGAGGGCAAGGGCGCAGCGGGCGCAGCCGTTGG
CGGCGCTGGTGGCATCACCGAGGTGCTGGGCTTCCCAACCGACGAGAAGGCCAAGAAGTACGGCACCACC
TCGGGCGGGGCAGACGGCAAGAAGCAGACCATCGAGTTTCTGCCGGCTGGCTCCTTTGTGCGCGTGGCCA
TGCTCAACGGCGTGGATGCGCCGACAGGCGGGCAAGCCCAATCGAACCCGCTGCCGGTGGCTTTCCATGT
GCTCGATGTCGCCAATCTGGCCAACAAGCACAAGCTGGACATCAAGGATTGCCGCATCGTGGCCGCCACC
TGGGGCGATCTGTCCTCAGAGCGGATGATGGGCCGCACCGAAACCCTGGCCTGCGTTATCAACGGCGAGG
CCGTTGAAATGGCGATCAAGGGCCAAGTGATTGGGGAAGACGGCAAGGCTGGGGTTCGGGGCCGTCTCGT
CACCAAGCAGGGCCAGTTGCTCGCCAATGCCCTGTTTGCCGGCGCGCTCAGTGGTATCGGCAAAGCCTTC
CAGTCCTCCGCAACCATCACCAGCACAGGCGGCGGCGGCATCACGCAAACCATCGACCCGGACAAGATCG
GGCAAGCCGCTATCGGTGGTGGGGTAGGCAGCGCGGGCCAGCAGCTCGCTCAGTACTACCTCAAGGCTGC
GGACAAGCTGTACCCCGTCATCGAAACCGATGGCGGCCGTACCGTCGAAATCCTCATCACCAAGGGCGCT
GTTTATTCCGGCAAGGCGCTCGCCAAGGACGATTACCGGGGCCTCCTGAAGCGCACCGGCACCAACTCCA
GGAGATACGAAGATGATTAA
 Primer design