SecReT4
Protein ID: 330827344
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4768
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]14567..15217 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDF4GGU6
KEGG IDadk:Alide2_4768
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 6.6e-24, Aligned region: 28..127
Protein Sequence: 216 a.a.     [Download]
>gi|330827344|ref|YP_004390582.1| type IV conjugative transfer system protein TraV [Alicycliphilus denitrificans K601]
MKALALTFGIGAVVALSGCSSMSGFDAKSEFACKAPDGILCESMSGIYANAQAKNLPGQRVNARGEAPVE
LSQAKAGSNVMTKPIYSGTPIRSAPRLLRVWFAPWEDTDGDLHDQSYVYLPVDSGRWLIEHNRRRIQDNY
RPVRAPSNVTAQAAQPQTAGAGQQRQSPGVLGQQPTPPADNGMESIGVRQDRMSNEQATELLNGIMRPGN
VIPDSE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|330827325|ref|NC_015423.1|:14567-15217 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGAAGGCACTGGCCTTGACCTTTGGCATCGGGGCCGTGGTGGCCCTATCCGGTTGCAGCAGCATGTCTG
GCTTTGATGCGAAATCCGAATTCGCGTGCAAGGCCCCGGACGGCATCTTGTGCGAGTCGATGAGCGGCAT
CTACGCCAATGCCCAGGCGAAGAACCTGCCGGGCCAGCGCGTGAATGCGCGCGGCGAGGCTCCGGTGGAA
CTTTCGCAGGCGAAAGCCGGCAGCAACGTGATGACCAAGCCCATCTACTCGGGCACGCCGATCCGCAGCG
CACCGCGCCTGCTTCGCGTCTGGTTCGCCCCGTGGGAAGACACCGATGGCGATCTGCACGACCAGTCCTA
CGTGTACCTGCCGGTCGATTCCGGCCGCTGGCTGATCGAGCACAACCGCCGCCGCATCCAGGACAACTAC
CGGCCGGTACGCGCCCCGTCGAATGTGACGGCCCAGGCTGCGCAGCCGCAAACGGCCGGCGCTGGCCAGC
AACGGCAAAGCCCTGGCGTGCTGGGGCAGCAGCCAACGCCTCCCGCTGACAACGGGATGGAGTCTATCGG
CGTCCGTCAAGACCGCATGAGCAACGAGCAAGCCACCGAGCTGCTGAACGGAATCATGCGCCCCGGCAAC
GTCATCCCGGACAGCGAATAA
 Primer design