SecReT4
Protein ID: 330827345
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4769
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]15255..17879 [+]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDF4GGU7
KEGG IDadk:Alide2_4769
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.7e-57, Aligned region: 45..289
AAA_10 [PF12846], Evalue: 5.9e-55, Aligned region: 488..776
Protein Sequence: 874 a.a.     [Download]
>gi|330827345|ref|YP_004390583.1| type-IV secretion system protein TraC [Alicycliphilus denitrificans K601]
MQDSMMDKLKGAAARFWDETVLGNTSDVGSQPAPVAAANEVTSLYGLHSILKYDQYDPDTGLFYNDNSVA
FCFEVIAQTGADDDMASRLNTLFTPVPPHYGIQWCLFGSPVLDDQFQAYMDQRHIAVDNGKTTPFFQELA
KRRVEYIYKAKGKPLWPNDNYVVKNIRLLFSITKAGSFRDAKLVEEMYELRETVRASLRTASLPSFPLDA
DGLISFLWPILNPESMFSKEPFPDLRYDDGKSIKNQVTAFGQHVRVKANELLFGLPPEKQGDEDKRIAVR
GFGVLQYPQKKELWEMANIIGSFFDDGLQYPCPFLVCGGVFTLDPNVVDGKAQIKAARTKQNAKSKMAEF
QPELQAQANDWDIVLHQLNNGGSMCELYHTLLLFAPKRVINRASQVALNVWRSERFTICPLQLLQLTALY
SSLPMTLTETVRDDLQKLRLITSKTTVNAVDMAPVIGEWKGAGDPVMMFFGRRGTPTFLDFYSNQQGNYN
VFVAGVSGSGKSVTMNEVVSAYRGIGARVWVIDVGRSYQNLIRLQKGTFLEFTPSTKLCINPFTWVGTDD
ELDFKAEMRMLKPMIGRMASPNAPLTEFQYALIGEAITAVWQDYGQDTNPTRIRDYLLSNIKNESGSTER
VAYELAKQLAPFTKDGVYGDFFNGRANISLDADMVGLELEELKNAPELRRVVLFVLTSRIAHDMYLTRDR
KKLCLVDEAWQLLGADKETAEFIEEGYRRARKYNGIFCVGTQGIEDAYKNDAAQAAYNNADWKILLRQDR
KNLEKLIEDGMVNFSPAVKRMLLSLRTERGRFSEMLISSPNGDSVVRHIPDPFSLLMASTNAQDFNECNA
LLEQGHSTMEALEIMLARRTPQEQLSPRRRKDDY
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|330827325|ref|NC_015423.1|:15255-17879 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGCAAGACAGCATGATGGACAAGCTAAAGGGTGCTGCCGCCCGGTTTTGGGACGAAACCGTGCTGGGCA
ACACCTCGGATGTCGGGAGCCAGCCGGCCCCCGTGGCGGCCGCCAACGAGGTGACGAGCCTCTATGGGCT
GCACAGCATCCTCAAGTACGACCAATACGACCCCGACACGGGCCTTTTCTACAACGACAACTCGGTGGCC
TTCTGCTTTGAAGTCATCGCGCAAACCGGCGCGGACGACGACATGGCGAGCCGCCTCAATACGCTCTTTA
CCCCGGTGCCGCCGCACTACGGAATTCAGTGGTGCCTGTTCGGTAGCCCGGTGCTGGATGACCAGTTCCA
AGCGTACATGGATCAACGCCATATCGCGGTGGACAACGGCAAGACCACGCCGTTCTTTCAGGAGCTGGCC
AAGCGCCGCGTGGAGTACATCTACAAGGCAAAGGGCAAGCCGCTTTGGCCCAATGACAACTACGTGGTGA
AGAACATCCGCCTGCTGTTCTCCATCACCAAAGCCGGTTCCTTCCGTGACGCCAAGCTGGTGGAGGAAAT
GTACGAGCTGCGCGAGACAGTGCGCGCTTCGCTGCGCACGGCAAGCCTGCCGTCCTTCCCCCTCGATGCT
GACGGGCTGATTAGCTTCCTGTGGCCGATCCTCAACCCCGAAAGCATGTTCAGCAAGGAGCCGTTCCCCG
ATCTGCGCTACGACGACGGGAAATCCATCAAAAACCAAGTCACGGCCTTTGGCCAGCATGTGCGCGTGAA
AGCCAACGAGCTGCTGTTTGGCCTGCCGCCCGAGAAGCAGGGCGACGAAGACAAGCGCATCGCCGTGCGT
GGCTTCGGCGTGCTTCAGTACCCGCAGAAGAAAGAGCTGTGGGAGATGGCCAACATCATCGGTTCGTTTT
TCGATGACGGCCTTCAATACCCGTGCCCATTCCTGGTGTGCGGTGGCGTCTTCACGCTTGACCCCAACGT
GGTGGACGGCAAGGCTCAGATCAAGGCCGCACGCACCAAGCAAAACGCCAAGTCCAAGATGGCCGAGTTC
CAGCCCGAGCTTCAGGCCCAGGCGAACGATTGGGACATCGTGCTGCACCAGCTCAACAACGGCGGCAGCA
TGTGCGAGCTGTACCACACGCTGCTGCTGTTCGCACCCAAGCGCGTCATCAACCGGGCAAGCCAAGTGGC
CCTGAACGTGTGGCGCAGCGAACGCTTCACGATCTGCCCGCTGCAACTGCTGCAACTGACGGCCCTGTAT
TCCAGCCTGCCCATGACGCTCACCGAGACGGTGCGCGACGACTTGCAGAAGCTACGCCTCATCACGTCCA
AGACCACGGTGAACGCGGTGGACATGGCCCCGGTGATTGGCGAATGGAAGGGCGCAGGCGACCCGGTGAT
GATGTTCTTTGGCCGTCGTGGCACCCCTACCTTCCTCGACTTCTACAGCAACCAGCAGGGCAACTACAAC
GTGTTCGTGGCGGGCGTGTCCGGTTCGGGCAAGTCCGTGACCATGAACGAAGTCGTTTCGGCCTATCGAG
GTATTGGCGCGCGGGTGTGGGTGATCGACGTGGGCCGCAGCTATCAGAACCTGATCCGGCTCCAGAAAGG
CACCTTCCTGGAGTTCACGCCGAGCACGAAGCTGTGCATCAATCCATTCACTTGGGTGGGCACTGACGAC
GAGCTGGATTTCAAGGCGGAAATGCGGATGCTCAAGCCGATGATCGGCCGCATGGCGTCCCCCAATGCGC
CGCTGACGGAATTCCAGTACGCGCTGATCGGGGAGGCGATTACCGCCGTCTGGCAAGACTACGGGCAGGA
CACCAACCCGACCCGCATCCGCGACTACCTGTTGAGCAACATCAAGAACGAGTCGGGCAGCACCGAGCGC
GTGGCCTACGAGCTGGCCAAGCAGCTCGCGCCGTTCACCAAGGATGGCGTCTATGGGGACTTCTTCAACG
GCCGCGCCAACATCAGCTTGGACGCCGACATGGTGGGGCTGGAGCTGGAGGAACTGAAGAACGCTCCCGA
GCTGCGCCGCGTGGTGCTGTTCGTGCTGACCTCGCGCATTGCCCACGACATGTATCTGACCCGCGACCGC
AAGAAGCTGTGTCTGGTCGATGAGGCATGGCAGCTCCTGGGGGCTGACAAGGAAACCGCAGAGTTCATCG
AGGAAGGCTACCGCCGCGCCCGGAAGTACAACGGCATTTTTTGTGTGGGCACGCAAGGTATCGAAGACGC
CTATAAAAATGATGCGGCCCAGGCGGCCTACAACAACGCCGACTGGAAGATTCTGCTGCGCCAAGACCGC
AAGAACCTGGAAAAGCTGATCGAGGACGGCATGGTGAATTTCTCGCCGGCCGTGAAGCGGATGCTGCTGT
CGCTGCGCACCGAGCGCGGCCGCTTCAGCGAAATGCTCATTTCCTCGCCCAACGGCGATTCCGTGGTGCG
CCACATCCCCGATCCCTTCTCCCTGCTGATGGCTTCGACCAACGCGCAGGACTTCAACGAATGCAACGCG
CTGCTGGAGCAGGGCCATTCCACGATGGAAGCCCTGGAAATCATGCTGGCCCGCCGCACCCCTCAAGAAC
AACTGTCCCCGCGCCGGAGGAAAGATGACTACTGA
 Primer design