SecReT4
Protein ID: 330827348
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4772
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]18760..19398 [+]
Producttype-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDF4GGV0
KEGG IDadk:Alide2_4772
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7e-09, Aligned region: 6..34
Protein Sequence: 212 a.a.     [Download]
>gi|330827348|ref|YP_004390586.1| type-F conjugative transfer system protein TraW [Alicycliphilus denitrificans K601]
MRFSKLIAALLIASILPAANAASLGSIGPTYPIGEESALDMIMKKLREKERSGELKRLQEEAIRRSMGSI
KNMKPVDGITTVRARAQRFIDPTVTYTKPVTTDDGRIVVPAGTKINPLDMTSLTKTLVFFDGRDPEQREA
VGRLVAKGGQLKVKPILVAGSWLDLTKAWKTQVFYDQKGTLSKRFGITAVPAVIRQQGKMLVLDEIPAKE
LQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|330827325|ref|NC_015423.1|:18760-19398 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGAGATTTTCTAAGCTGATCGCAGCCCTGCTGATCGCCTCGATCCTGCCTGCCGCGAACGCGGCGAGCT
TGGGCAGCATCGGGCCGACCTACCCGATTGGGGAGGAAAGCGCCCTCGACATGATTATGAAGAAGCTGCG
CGAAAAGGAGCGTAGCGGCGAGCTGAAGCGGTTGCAGGAAGAAGCCATCCGCCGCTCGATGGGCAGCATC
AAGAACATGAAGCCGGTGGACGGTATCACCACCGTGCGCGCCCGCGCGCAGCGTTTCATCGACCCCACCG
TGACCTACACCAAGCCGGTGACGACCGACGACGGCCGCATCGTGGTGCCGGCTGGAACGAAGATCAACCC
GCTGGACATGACCAGCCTGACGAAGACGCTGGTTTTCTTCGACGGCCGCGACCCCGAACAGCGCGAAGCA
GTGGGGCGCTTGGTGGCCAAGGGCGGCCAGCTCAAGGTGAAGCCGATTCTCGTTGCTGGGTCTTGGCTCG
ACCTCACCAAAGCCTGGAAGACCCAAGTTTTCTACGACCAGAAGGGCACCCTTTCCAAACGGTTCGGCAT
CACGGCCGTGCCGGCTGTGATTCGTCAGCAGGGAAAGATGCTTGTGCTCGATGAGATTCCCGCGAAGGAG
CTGCAATGA
 Primer design