SecReT4
Protein ID: 330827349
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4773
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]19395..20396 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDF4GGV1
KEGG IDadk:Alide2_4773
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.3e-84, Aligned region: 27..328
Protein Sequence: 333 a.a.     [Download]
>gi|330827349|ref|YP_004390587.1| TraU family protein [Alicycliphilus denitrificans K601]
MKRWLVMAFMVLAATFARESMAGVCQGKFANPITDICWSCLFPLTLGGTPIMTMGQEDTGNPDGFLCTCT
NPLRIGIKTGFWEPARRVDVTRTPYCFVSLGGIKLDPGIRAPEGEIRLQQDNTKQSNYQVHWYADPILYW
LEVILDNPCLETGSFDVAYITEVDPTWNDDELTMLLNPETFLFGNPIAQAACAGDCVLSSAGFGSNALFW
CAGCQGSIYPFNGHVQAHVSHVQASSLLVQRMTAKLHREFLMWGTSGADGLCGIYPEPVMDKTQYKYQML
YPIPQTEKINGRCCQPYGRTTAIWGAGKSYPYAGEDFAYMIFRKKNCCLGVGF
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|330827325|ref|NC_015423.1|:19395-20396 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGAAACGCTGGCTTGTAATGGCTTTCATGGTGCTCGCGGCGACTTTCGCGCGCGAAAGTATGGCCGGCG
TGTGCCAGGGCAAGTTTGCCAACCCCATCACCGATATTTGCTGGAGCTGCCTGTTCCCGCTGACGTTGGG
CGGCACGCCGATCATGACGATGGGCCAGGAGGACACCGGCAACCCGGACGGCTTCCTCTGCACCTGCACC
AACCCGCTGCGCATCGGCATCAAGACCGGCTTTTGGGAGCCGGCGCGGCGCGTGGATGTGACCCGCACCC
CGTACTGCTTTGTCTCGCTGGGAGGCATCAAGCTCGATCCCGGTATCCGTGCCCCGGAAGGCGAGATCCG
TTTGCAGCAGGACAACACCAAGCAGTCCAACTATCAGGTTCATTGGTACGCCGATCCGATCCTTTATTGG
CTGGAGGTGATCCTGGATAACCCGTGCCTGGAGACGGGTTCCTTTGACGTGGCCTACATCACCGAAGTCG
ATCCGACTTGGAACGACGACGAGCTGACCATGCTGCTGAACCCGGAAACTTTCCTGTTCGGCAACCCCAT
TGCCCAAGCCGCGTGTGCCGGCGACTGCGTGTTGTCATCGGCTGGCTTTGGCAGTAACGCGCTTTTCTGG
TGCGCCGGCTGCCAGGGTTCGATCTACCCCTTCAACGGCCATGTGCAGGCCCACGTCTCACACGTACAAG
CCAGTTCGCTGCTGGTGCAGCGCATGACGGCCAAGCTGCACCGCGAATTCCTGATGTGGGGCACCTCTGG
CGCTGACGGCTTGTGCGGCATCTATCCCGAGCCGGTGATGGACAAGACCCAATACAAGTACCAGATGCTC
TACCCGATCCCGCAGACGGAAAAGATCAACGGGCGCTGCTGCCAACCCTATGGCCGCACGACCGCGATTT
GGGGCGCTGGCAAGAGCTACCCGTATGCCGGCGAAGACTTCGCCTACATGATTTTCCGCAAGAAAAACTG
CTGCCTGGGAGTGGGATTCTGA
 Primer design