SecReT4
Protein ID: 330827350
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4774
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]20396..21172 [+]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDF4GGV2
KEGG IDadk:Alide2_4774
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.3e-32, Aligned region: 127..236
Protein Sequence: 258 a.a.     [Download]
>gi|330827350|ref|YP_004390588.1| type-F conjugative transfer system pilin assembly protein TrbC [Alicycliphilus denitrificans K601]
MNKKTVIGLMLLAAFARESVAQSTPTASQLDQERQRIELERKQMFDPNNPASKAKKGAMPNSADIDREMR
RVDRERKQMFDPNNPATKNAANVFPNVPTPERAGIDIEALAKQYEQKAQARKMDDLMIFASFTMPAESLK
RIVSQANRVGASVVLRGFKNNSLKDTALAIKELGEQGGNVLVNPNAFTKYKVKAVPTMVLAKAATIDQVD
NEGCALPDNFVAVAGDVSLDYALDEIVRRAPQFEAVASRYLRQIRGNQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|330827325|ref|NC_015423.1|:20396-21172 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGAACAAGAAAACTGTCATCGGGCTGATGCTGCTGGCCGCTTTCGCCCGCGAAAGCGTGGCGCAGAGCA
CGCCGACCGCATCCCAGCTCGACCAAGAACGCCAACGCATCGAGCTTGAGCGCAAGCAGATGTTTGACCC
GAACAACCCCGCCTCGAAGGCCAAGAAGGGCGCTATGCCCAACTCGGCCGACATCGACCGGGAAATGCGC
CGCGTAGATCGTGAGCGCAAGCAGATGTTCGATCCAAACAACCCCGCGACCAAGAACGCCGCCAACGTGT
TCCCCAACGTGCCGACGCCGGAGCGCGCCGGGATCGACATCGAGGCGCTGGCCAAGCAATACGAGCAAAA
GGCCCAGGCCCGCAAGATGGATGACCTGATGATTTTCGCCAGCTTCACGATGCCGGCCGAATCACTCAAG
CGGATCGTCAGCCAAGCCAACCGGGTGGGGGCTTCTGTGGTGCTGCGCGGTTTCAAGAACAACTCGCTGA
AGGATACGGCGCTGGCCATCAAGGAGCTGGGAGAGCAGGGCGGCAACGTCCTGGTGAACCCCAACGCCTT
CACCAAGTACAAGGTCAAGGCTGTTCCCACGATGGTGCTGGCCAAGGCCGCAACCATCGACCAAGTGGAC
AACGAGGGCTGCGCCCTCCCTGACAACTTTGTGGCAGTGGCCGGTGACGTTTCGCTGGACTACGCCCTGG
ACGAGATTGTGCGCCGCGCGCCGCAGTTTGAAGCCGTGGCGTCTCGCTACCTTCGCCAGATCAGGGGGAA
CCAATGA
 Primer design