SecReT4
Protein ID: 330827352
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4776
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]22464..23708 [+]
ProductMating pair stabilization TraN
Component typeTraN_F
UniProt IDF4GGV4
KEGG IDadk:Alide2_4776
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.2e-48, Aligned region: 23..191
TraN [PF06986], Evalue: 1.2e-48, Aligned region: 292..360
Protein Sequence: 414 a.a.     [Download]
>gi|330827352|ref|YP_004390590.1| Mating pair stabilization TraN [Alicycliphilus denitrificans K601]
MMMKKILAALAFVASFSAFAAPDCQKTGTVCTAPNQTRNVSGLSVFRECWEYQDTYQCRSQNMVNDCQPL
RDKGCSQIGSSCVERDDSGTCVMYEQKYNCPDKPETYTEKTVCDQSAFCQNGGAGCFDTSAPPDKDFGQA
AVMMEAAREAGVYGIDPNKVEIFKGYMEECSIKVLGGTTLKSCCKSAGGGAAFSNYALLGAGMKAAGEAG
RESIVLGSKYMYDSLYGQLDSSLVDKGLGAMNSWASGLGDGVFNPQFGFYGFTFEFTFANGFQFVGFDPY
SFALSVAIMLVQEWLSCDSAEQVMAMKRGQNLCVHIETYCSKKVLKVCVEKKERHCCFNSKLAKIINRQG
RAQLGMPMNSCGGFNQAQLQALDFSRIDLSEFIADIVPKDVPASTMSNRVQQTVNKKVQSYYDQ
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|330827325|ref|NC_015423.1|:22464-23708 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGATGATGAAGAAGATTCTTGCCGCATTGGCCTTTGTCGCCAGCTTCAGCGCCTTCGCAGCGCCTGACT
GCCAGAAGACGGGAACGGTTTGCACCGCGCCCAACCAGACCCGCAACGTGTCGGGCCTGTCCGTCTTTCG
TGAATGCTGGGAATACCAGGACACCTATCAATGCCGCAGCCAGAACATGGTCAACGACTGCCAGCCGCTG
CGAGACAAGGGGTGCTCTCAGATCGGATCGTCATGCGTGGAGCGCGACGATTCCGGCACCTGCGTGATGT
ACGAGCAGAAATACAACTGCCCGGACAAGCCTGAAACCTACACCGAGAAAACGGTGTGCGATCAAAGCGC
CTTCTGCCAGAACGGCGGGGCTGGGTGCTTTGATACCAGCGCGCCACCCGACAAGGACTTTGGCCAAGCG
GCCGTGATGATGGAGGCCGCCCGCGAGGCCGGCGTGTACGGCATCGACCCGAACAAGGTCGAAATCTTCA
AGGGCTACATGGAGGAATGCAGCATCAAGGTCTTGGGTGGCACCACGCTCAAGAGCTGCTGCAAGTCAGC
CGGTGGTGGCGCTGCCTTCAGCAATTACGCGCTCCTGGGCGCCGGCATGAAGGCGGCAGGCGAAGCGGGC
CGCGAATCCATCGTGCTGGGTTCCAAGTACATGTACGACTCGCTGTATGGCCAGCTCGACAGCTCCCTTG
TAGATAAGGGACTTGGCGCAATGAATAGCTGGGCCTCCGGCTTGGGTGATGGTGTCTTCAATCCGCAATT
CGGGTTCTATGGCTTCACTTTTGAGTTCACCTTTGCCAACGGCTTCCAGTTCGTCGGTTTTGACCCGTAC
AGCTTCGCCCTGTCCGTGGCAATCATGCTGGTGCAGGAATGGTTGAGCTGCGATTCGGCCGAGCAGGTCA
TGGCCATGAAGCGCGGCCAAAACCTGTGCGTCCATATTGAGACGTATTGCAGCAAGAAGGTGCTCAAGGT
CTGCGTGGAGAAGAAGGAACGCCACTGCTGCTTTAACTCCAAGCTGGCCAAGATCATCAACCGCCAAGGC
CGCGCCCAACTCGGGATGCCGATGAATAGCTGCGGCGGCTTCAACCAGGCGCAGCTCCAGGCCCTCGATT
TCTCCCGGATTGATCTGTCCGAGTTCATCGCGGACATCGTGCCCAAGGATGTGCCGGCATCGACCATGAG
CAACCGGGTGCAGCAGACCGTCAACAAAAAAGTTCAGAGCTACTACGACCAATGA
 Primer design