SecReT4
Protein ID: 330827354
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4778
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]24072..24884 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDF4GGV6
KEGG IDadk:Alide2_4778
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.6e-72, Aligned region: 35..259
Thioredoxin_2 [PF13098], Evalue: 7.7e-06, Aligned region: 165..237
Protein Sequence: 270 a.a.     [Download]
>gi|330827354|ref|YP_004390592.1| hypothetical protein Alide2_4778 [Alicycliphilus denitrificans K601]
MMKRSLLLLALLSGYANAQSLDYPSVWQCDANKPNWYCDMEDAKPQPVQPTPAPARQQTSRKADQPKRIE
LKDIKTAEQLRQELKRREDVAVMNPTDQNMKDYLELWQMTQDKGAVFADNWRRVVWQNPSLDYAQKRPVN
NSAIKIYDEGRIQNEEQQLKMLAKEHGLIFFFRSDCPYCHAMAPTLKMLSDKYGIEVLPVSVDGMGLPEF
PNPRDGRAQAAAWGIERVPALFIGSKQTGDRAPVGFGMMALTEIVNRIFVLTGTKPGDNF
 
Nucleotide Sequence: 813 bp     [Download]
>gi|330827325|ref|NC_015423.1|:24072-24884 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGATGAAGCGAAGCCTTCTCCTGCTGGCCCTGCTGTCCGGGTACGCCAATGCGCAGTCACTGGATTACC
CGTCTGTTTGGCAGTGCGATGCGAACAAGCCCAACTGGTACTGCGACATGGAAGACGCCAAGCCGCAACC
TGTGCAGCCGACGCCGGCACCGGCACGGCAGCAGACTAGCCGCAAGGCTGACCAGCCAAAGCGCATCGAG
CTGAAGGACATCAAGACCGCCGAGCAACTGCGACAAGAACTGAAGCGCCGGGAAGACGTGGCGGTGATGA
ACCCCACCGACCAGAACATGAAGGACTACCTGGAGCTTTGGCAGATGACGCAGGACAAGGGGGCTGTCTT
CGCTGACAACTGGCGGCGCGTGGTCTGGCAAAACCCGAGCCTCGACTACGCGCAAAAGCGGCCGGTCAAT
AACTCCGCGATCAAGATTTACGACGAAGGCCGCATTCAGAACGAGGAACAGCAACTGAAGATGTTGGCCA
AGGAGCACGGGCTGATCTTCTTCTTCCGTAGCGACTGCCCGTACTGCCATGCAATGGCCCCGACGCTGAA
GATGCTTTCCGACAAGTACGGCATCGAGGTGCTGCCGGTATCAGTCGATGGCATGGGCCTGCCCGAGTTC
CCGAACCCCCGCGACGGCCGCGCGCAAGCTGCGGCTTGGGGGATTGAGCGCGTGCCGGCACTGTTCATTG
GCTCAAAGCAGACCGGCGACCGTGCGCCCGTGGGCTTCGGAATGATGGCCCTAACCGAAATCGTCAATCG
AATCTTTGTCCTCACCGGCACCAAGCCCGGCGATAACTTCTAA
 Primer design