SecReT4
Protein ID: 330827355
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4779
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]24895..26301 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDF4GGV7
KEGG IDadk:Alide2_4779
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.8e-112, Aligned region: 24..383
Protein Sequence: 468 a.a.     [Download]
>gi|330827355|ref|YP_004390593.1| TraH family protein [Alicycliphilus denitrificans K601]
MLLKKVTALVTAFAFTTSTYAMNMQELFDSVNAQGNVSNPAVLQGQTMNLYTGGSLFMRMPKRTYQLATV
TPPSWNAGCGGIDLFAGGFSFINKEQFVAMLRNIGSNALGYGFKLAIQNLCPTCDNVMQALQATAQAANR
LNMDSCEAAKGIVNAAVPDTWTRGKQNAAKNFGVDTNIFENITDAWTNVMNSESRANQTVNSAASARPEA
KDQLPTGNVVWKALKKLDGVTDEQRMILMSMIGSMIFPTGDTPQLPIPLLRKEITVEALVGARTTSDTIT
VPIWRCDTTSADGCLSPTEDEVTTKSFKTMVREKMEKISDKIANRSAHDDMAATIGFLNATDLPIYKMLA
VTTTLNNTSMADALIGRYQELIAAKYAEVYIQRAVTDLRGAMAKFSAAADATQAAELGKMKPELEEISRA
AKQVLATAYSQTISTYNIAQEVQYMERALNANLSQTLRNSLAFGKSLR
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|330827325|ref|NC_015423.1|:24895-26301 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGCTACTGAAAAAAGTAACGGCGCTGGTGACGGCATTTGCTTTCACCACCTCTACCTACGCCATGAACA
TGCAGGAGCTTTTCGACTCCGTGAATGCTCAAGGCAACGTCAGCAACCCGGCCGTGCTGCAAGGCCAGAC
GATGAACCTCTACACCGGAGGCAGTCTGTTCATGCGGATGCCCAAGCGCACCTACCAACTGGCGACGGTG
ACGCCGCCGAGCTGGAACGCTGGGTGCGGCGGCATTGACCTGTTCGCGGGCGGCTTCTCGTTCATCAACA
AAGAGCAGTTCGTGGCCATGCTGCGCAACATTGGCTCGAATGCCCTGGGCTACGGCTTCAAGCTGGCCAT
TCAGAACCTGTGCCCGACCTGCGACAACGTGATGCAGGCCCTGCAAGCCACGGCGCAAGCTGCCAATCGT
CTCAACATGGATTCCTGCGAGGCGGCCAAGGGGATCGTCAATGCGGCCGTGCCCGACACCTGGACGCGCG
GCAAGCAAAACGCGGCTAAGAACTTCGGTGTGGACACCAACATTTTCGAGAACATCACCGACGCTTGGAC
GAACGTGATGAACAGCGAAAGCCGGGCCAACCAGACGGTGAACTCGGCGGCCAGCGCGCGACCCGAGGCG
AAAGACCAGCTCCCGACCGGCAACGTGGTTTGGAAGGCGCTCAAGAAGCTCGATGGCGTCACCGACGAGC
AACGCATGATCCTGATGTCGATGATCGGCAGCATGATTTTCCCGACCGGCGACACCCCGCAACTGCCTAT
CCCGCTGCTGCGCAAGGAAATCACGGTGGAGGCCCTGGTGGGTGCGCGTACCACCTCCGACACCATCACG
GTGCCGATCTGGCGTTGCGACACCACCAGCGCGGACGGCTGCTTGAGTCCGACCGAGGATGAAGTGACCA
CCAAGAGCTTCAAGACGATGGTGCGGGAGAAGATGGAAAAAATCTCCGACAAGATCGCCAACCGTTCAGC
TCACGACGACATGGCGGCCACCATCGGCTTCCTGAACGCAACCGATCTGCCCATCTACAAGATGCTGGCC
GTGACGACAACCCTCAACAACACCTCGATGGCCGACGCGCTGATTGGCCGCTACCAGGAGCTGATCGCCG
CCAAATACGCCGAGGTTTACATCCAGCGTGCCGTCACCGACCTGCGCGGCGCGATGGCGAAGTTCTCTGC
CGCAGCCGATGCCACCCAGGCCGCCGAGCTGGGCAAGATGAAGCCCGAGCTGGAGGAAATTTCGCGCGCG
GCAAAGCAGGTGCTGGCCACTGCCTACTCGCAGACCATCAGCACCTACAACATCGCCCAGGAGGTGCAGT
ACATGGAGCGTGCGCTGAATGCCAACCTGTCGCAGACGCTGCGTAACTCGCTCGCCTTCGGCAAGAGCCT
GCGCTAA
 Primer design