SecReT4
Protein ID: 330827356
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4780
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]26313..29360 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDF4GGV8
KEGG IDadk:Alide2_4780
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.4e-107, Aligned region: 4..464
Protein Sequence: 1015 a.a.     [Download]
>gi|330827356|ref|YP_004390594.1| TraG domain-containing protein [Alicycliphilus denitrificans K601]
MDIEIQTYWNVETLYYVFNAVASMMAGAGFAGLLKLVFLFAIAIGMFGYMNKQLEMAKWFIHALAFVTVL
NLPIARVALTDKTGLEPPRVVDNVPFALAVTAQTTNLVFGALTNTYETVFGVPEDLGLQKGDVGFGHRIL
KQVNNATIRDPSLRSDLMQFIKECTLYDVKDGEITPQQIVGGTDTWNVIFNNTSPARFVTYNTLTNAPTT
DTCTNVAAILKEKVNDAVTAGQAFYGKQAFTRASSDAIATSMFVSTVGTSYDWILNNSSNASDAMKQAMF
NNIWKEAGTELPALLNDPARVAEVNALAGAAQAARQADGSNSTLSLLAQETLPHMRNWIEAIIYGLFPVV
VVLMVVSSTEGAKKIIAGYMMSLAWIGLWPILFAVINHLSLMHLRYKARALELAAGVPFQLTDAFDATLT
NEQAAIGYMVVLVPFIAGAIIKLGQGGFMGVADRMMTGFASAGAAVGASNASGNVSMGQAGLDTASVNTT
SMNKYDSNIGLQGGGATIGRGNGSTATMAANGAVALQQLQNRMLTQMNMDHRLEAGRNQEAHRTDITSTG
DQLARRHGDSSSLTDVKGHDTTRGQYQNTGVVAARGSEGGYGGQHSTGQNLDRNFREGSHFRTAAGANDQ
LHMNLGVGRGNPNGGGAPGAGGAGGAPDPREEKRIADAMKQGGANQQQIDQALKNYRGGKGGAQPSGGLI
NAGLGYNGAKTYTAEHGRDRGVDTVHGNQEAARTERTFAERGSRTEQAGTGNQSAQNDRHGRDAALTNVD
EVSRVRDVSDRREFGTGDRANRSDSNSFTTHKDLMADPYLFEKVAARNGMTAMRFANQSEDRIMDMVQDY
VSEKGMVQQATTMPQQTFAGEKLPTTKGELEKQSAKDRAGIPQDIQGVHKKKVAQTGYGGTAPLKVDTSA
PPIIAESRGDVQGQLDPKNKGSIPARAGALDENVNAWASPDKAVGAGRANPAAVNEDNMIRDGKDTVQKA
WDKLTGGDGTADGEKLNDNMKRETAASVQINNGSK
 
Nucleotide Sequence: 3048 bp     [Download]
>gi|330827325|ref|NC_015423.1|:26313-29360 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
GTGGACATCGAAATTCAAACCTACTGGAACGTAGAAACGCTCTACTACGTCTTCAACGCCGTGGCCTCGA
TGATGGCCGGCGCTGGCTTCGCTGGCTTGCTGAAGCTGGTTTTCCTGTTCGCCATCGCAATCGGCATGTT
CGGCTACATGAACAAGCAGCTCGAAATGGCGAAGTGGTTTATCCACGCCCTGGCCTTTGTGACCGTGCTC
AATCTGCCGATCGCGCGCGTTGCCTTGACCGACAAGACAGGGCTGGAGCCGCCGCGCGTGGTTGATAACG
TGCCCTTTGCCCTGGCCGTCACTGCGCAGACGACCAATCTGGTGTTCGGCGCGCTGACCAACACCTATGA
AACGGTCTTCGGTGTCCCTGAAGACCTGGGCCTGCAAAAAGGGGATGTGGGCTTCGGGCACCGCATCCTG
AAACAAGTCAATAACGCGACGATCCGCGACCCCAGCTTGCGCTCCGACCTGATGCAGTTCATCAAGGAAT
GCACGCTGTACGACGTGAAAGACGGTGAAATCACCCCGCAGCAGATTGTGGGCGGCACCGATACCTGGAA
CGTGATTTTCAACAACACGAGTCCAGCCCGCTTCGTCACCTACAACACCCTGACGAATGCGCCTACCACC
GATACCTGCACCAATGTTGCGGCCATCCTGAAGGAGAAGGTCAACGACGCGGTAACGGCTGGCCAAGCCT
TCTACGGCAAGCAGGCTTTCACGCGGGCAAGCAGTGATGCTATCGCTACCAGCATGTTCGTTTCGACGGT
GGGCACGTCCTACGACTGGATTCTGAACAACTCCAGCAACGCCTCAGACGCGATGAAGCAGGCGATGTTC
AACAACATCTGGAAGGAGGCCGGCACCGAGCTGCCGGCGCTGCTGAACGATCCTGCGCGGGTGGCCGAGG
TTAATGCCCTGGCCGGCGCTGCCCAAGCGGCGCGGCAAGCGGACGGCTCCAACAGCACCTTGAGCCTGCT
GGCGCAAGAGACGCTGCCCCACATGCGCAACTGGATCGAGGCAATCATCTACGGTCTGTTCCCGGTTGTT
GTGGTGCTGATGGTTGTCAGCTCGACCGAGGGGGCAAAGAAGATCATTGCGGGCTACATGATGTCGCTGG
CCTGGATCGGCCTGTGGCCAATCTTGTTTGCCGTCATCAACCACCTGTCGCTCATGCACTTGCGCTACAA
GGCGCGCGCGCTGGAGCTGGCGGCCGGTGTGCCGTTCCAGCTCACCGATGCTTTCGACGCCACGCTGACC
AACGAGCAGGCGGCCATCGGCTACATGGTTGTCCTGGTGCCATTCATCGCCGGGGCCATCATCAAGCTGG
GGCAGGGCGGTTTCATGGGTGTTGCCGACCGGATGATGACCGGCTTTGCCTCTGCCGGGGCGGCGGTGGG
CGCAAGCAATGCCAGCGGCAATGTCAGCATGGGCCAAGCTGGACTTGATACCGCATCGGTCAACACGACC
TCGATGAACAAGTACGACAGCAACATCGGCCTGCAAGGTGGCGGGGCAACCATCGGTCGGGGCAATGGCT
CGACGGCCACGATGGCCGCGAACGGCGCGGTTGCCTTGCAGCAGCTCCAAAACCGGATGCTGACGCAGAT
GAACATGGATCACCGACTGGAAGCCGGCCGCAACCAGGAAGCGCATCGTACCGACATCACATCGACCGGG
GATCAACTGGCGCGCCGGCACGGCGACAGCTCCAGCCTCACGGACGTGAAGGGGCACGATACAACCCGTG
GTCAATATCAGAATACGGGTGTGGTGGCGGCTCGCGGGAGCGAGGGTGGGTATGGTGGCCAGCACTCAAC
CGGCCAGAACTTGGATCGCAACTTCCGTGAGGGTTCGCACTTCCGCACGGCGGCCGGTGCCAATGACCAG
CTCCACATGAATTTGGGTGTTGGCCGTGGGAACCCCAACGGCGGCGGTGCGCCTGGTGCTGGCGGTGCAG
GCGGTGCGCCTGATCCGCGCGAGGAAAAGCGCATTGCCGACGCCATGAAGCAGGGCGGCGCGAACCAGCA
ACAGATCGACCAAGCTCTGAAGAACTACCGGGGCGGCAAGGGTGGTGCCCAGCCTTCGGGCGGCCTCATC
AACGCGGGCCTGGGGTACAACGGCGCGAAGACCTACACGGCCGAGCACGGCCGGGATCGGGGCGTGGATA
CGGTTCATGGCAACCAGGAAGCCGCGCGCACCGAGCGCACGTTTGCTGAACGCGGCTCACGAACCGAGCA
GGCCGGGACGGGCAACCAATCGGCCCAAAACGACCGCCACGGCCGCGATGCAGCCCTCACAAACGTGGAT
GAAGTTTCCCGCGTGCGTGATGTCTCTGACCGCCGTGAGTTCGGTACTGGCGACCGCGCCAACCGTAGCG
ACAGCAACAGCTTCACGACTCACAAGGATCTGATGGCCGATCCGTATCTGTTCGAGAAGGTGGCCGCGCG
CAATGGCATGACCGCCATGCGTTTCGCCAACCAATCCGAAGACCGGATCATGGACATGGTGCAGGACTAC
GTGAGCGAGAAGGGCATGGTTCAACAAGCTACCACCATGCCGCAGCAGACTTTCGCAGGCGAAAAACTGC
CGACCACGAAGGGCGAGCTGGAGAAGCAATCCGCCAAGGATCGCGCCGGCATCCCGCAGGACATCCAGGG
CGTCCACAAGAAGAAGGTGGCACAGACCGGCTACGGCGGAACCGCTCCGCTCAAGGTCGATACCTCTGCG
CCTCCGATCATTGCGGAATCCAGAGGGGACGTACAGGGCCAGCTCGACCCGAAGAACAAGGGCAGCATCC
CGGCGCGTGCTGGGGCCTTGGACGAGAACGTGAATGCCTGGGCCAGCCCGGACAAGGCTGTAGGCGCTGG
GCGGGCCAATCCCGCAGCCGTCAACGAGGACAACATGATCCGCGACGGCAAGGACACCGTTCAGAAGGCT
TGGGACAAGCTGACTGGCGGCGACGGTACGGCAGACGGCGAAAAGCTGAACGACAACATGAAGCGGGAAA
CGGCCGCCTCGGTTCAGATCAACAACGGCAGCAAGTAA
 Primer design