SecReT4
Protein ID: 331267230
T4SS name [ID]Tra_Tn [646]
Gene symbol-
Locus tagSOR_1873
StrainStreptococcus oralis Uo5
Repliconchromosome [GenBank: NC_015291] [Browse all T4SS(s) in this replicon]
Location [Strand]1829696..1832143 [+]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDF2QFV1
KEGG IDsor:SOR_1873
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-33, Aligned region: 468..763
Protein Sequence: 815 a.a.     [Download]
>gi|331267230|ref|YP_004326860.1| hypothetical protein SOR_1873 [Streptococcus oralis Uo5]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYH
LSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYK
LSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVL
YGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGIS
SRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSIS
LEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|331265438|ref|NC_015291.1|:1829696-1832143 Streptococcus oralis Uo5, complete genome
ATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGT
TCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGA
CGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCAT
CTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTT
TGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTAC
CATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTT
ACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCA
ATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAGCTCCAATGT
GGCGGAAGCTCTGGAAAGTGTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTACAAG
CTGTCTTATGTGGTAAGGGTATCAGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATGAAGTGAAAG
ATTTTTATGACGATTTAAGCGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACATGAAGAATT
TTTACCTGCCAGCAAGCGTTATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTCGCTGGTTTA
GGTTTTGGTGCTACTCAAATGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGATACTGGAC
GCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTC
GGCTTTTGTTGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCGGTGCTT
TATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTGCCAGAGA
TTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACCCTTATGT
GATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGGGATTTCC
TCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAAGTACGAG
GGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCGACCATAT
CGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTCTATCAGC
TTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCCTTTGAGG
AATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGTAGCACAA
GGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTCGTGACCC
AAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTCGTTCCAC
TGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAATCAGAAG
CGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGT
TCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGGTGTAA
 Primer design