SecReT4
Protein ID: 33152061
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0920
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]735343..735513 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ7VMQ3
KEGG IDhdu:HD0920
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 6.6e-16, Aligned region: 2..52
Protein Sequence: 56 a.a.     [Download]
>gi|33152061|ref|NP_873414.1| hypothetical protein HD0920 [Haemophilus ducreyi 35000HP]
MQSAYQGLISGWQHGIKKVPAMLFQFPNSEDVVVYGETDVVKAKKQWQSWFEQQNK
 
Nucleotide Sequence: 171 bp     [Download]
>gi|33151282|ref|NC_002940.2|:735343-735513 Haemophilus ducreyi 35000HP chromosome, complete genome
TTGCAATCGGCATATCAGGGCCTTATCAGCGGTTGGCAACATGGTATTAAAAAAGTACCGGCGATGTTAT
TTCAATTTCCCAATAGCGAAGATGTCGTTGTTTATGGTGAAACGGATGTGGTCAAGGCCAAAAAACAATG
GCAATCCTGGTTTGAGCAACAAAATAAATAA
 Primer design