SecReT4
Protein ID: 33152062
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0921
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]735782..736438 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ7VMQ2
KEGG IDhdu:HD0921
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.6e-65, Aligned region: 9..205
Protein Sequence: 218 a.a.     [Download]
>gi|33152062|ref|NP_873415.1| hypothetical protein HD0921 [Haemophilus ducreyi 35000HP]
MNMVSQGVKGGEYRSPQKNYTQLTFKNVDAIGHPQGAISQMLNSTGYYCQSQTTPFVPYFLSSLDFFAWR
QAIPEMFYPEALVPGMREIRGNGETWGNIFPRSGAVTQVDDYKASAVSVHRVADFLTRMAQPHIYLPTAK
QEQGQNGHWYPDPVQEGEVGNHKWQQLHPQLSQSCSIFPDTPPAQLSENGSYAWALWRPYKCCKRRGQTF
LYSVDWSN
 
Nucleotide Sequence: 657 bp     [Download]
>gi|33151282|ref|NC_002940.2|:735782-736438 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGAACATGGTCAGTCAAGGTGTGAAAGGCGGCGAATATCGTTCACCACAAAAAAACTATACCCAGCTTA
CTTTTAAAAACGTTGATGCCATCGGACACCCCCAAGGCGCAATCAGCCAAATGCTAAACAGTACCGGCTA
CTATTGCCAAAGCCAAACCACACCATTTGTACCTTATTTTTTAAGTAGTTTAGATTTTTTTGCTTGGCGC
CAGGCTATTCCGGAAATGTTTTACCCTGAAGCCTTGGTGCCGGGAATGCGAGAGATTCGAGGTAACGGTG
AAACCTGGGGAAATATCTTTCCGCGTAGCGGTGCAGTCACCCAAGTTGATGATTATAAAGCATCGGCGGT
TTCCGTACATCGTGTCGCCGATTTCTTAACGCGTATGGCACAACCTCATATTTATCTTCCTACGGCAAAA
CAAGAGCAAGGACAAAATGGTCATTGGTATCCGGATCCTGTGCAAGAAGGTGAAGTCGGTAATCACAAGT
GGCAACAACTTCACCCGCAATTATCCCAATCTTGCAGTATTTTCCCGGATACACCGCCTGCTCAATTATC
GGAGAACGGTAGTTATGCTTGGGCATTATGGCGACCGTACAAATGTTGTAAACGTCGTGGGCAAACCTTT
TTATATAGCGTTGACTGGTCCAATTAA
 Primer design