SecReT4
Protein ID: 33152063
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0922
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]736465..738462 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ7VMQ1
KEGG IDhdu:HD0922
PDB IDNA
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 8.6e-37, Aligned region: 533..663
Protein Sequence: 665 a.a.     [Download]
>gi|33152063|ref|NP_873416.1| hypothetical protein HD0922 [Haemophilus ducreyi 35000HP]
MSNFIKKSHIALSVSLFINLGISSPLYANSVMNKLDFSKADSILSDKVFYQIGGGVGYMAPPTRSNTINA
AEFGIGWKANLMCGNFDIKTTIKNQLNGITEGFKDLYSNVIESATGAVASLPAMIIQRANPQLYDILTNG
LYQGKIDFANLKTNCEEMSKRLADATLDGRWSASADMEKYKMLLTSEPDANKVQKQLEDNKGKAGKTWVG
NQPKGGEGQEPIKLVEDVATAGYNILNNRPVLEKKPISGSNCSGLLCQTWEDPKQLSEWLTKVVGEQTLS
TCVENCGTPTSSKPGVGLTPEIEEENIRTLSNLEKALNMPVPPPEVLAQLSSNTIPVTRGLIEALREDPD
VELLSQRLASELALSKSMEKMLLARRSILAGMREPNVINNKDATDELEKILNVIDREIEQINMETSLQKS
ITGNTASAILQNKERRDINSGSHGLQQDSLDKRLNQLTNGTFQNETDTIDPNDINIQRKPIVLGVPSVAS
SGTVARPSFGGSGGTSTAGNPNVNVPNNQITAKSKKEFIQQAMPIAKAIEEKWGVPAEVVIAQAALESGW
GKHVKGNAYFGIKGKGSQGSINFGTHEVINGKKISINDNFASYGGFGDAANGYGEFLNKNKRYREAFKHK
DNPVEFAKAIARAGYATDPDYANKLTKIIQSNKFS
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|33151282|ref|NC_002940.2|:736465-738462 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGTCTAATTTTATAAAAAAATCACATATCGCTTTATCTGTTTCGCTTTTCATTAACCTAGGAATAAGCT
CACCGCTCTATGCTAATTCGGTGATGAATAAACTGGATTTTAGTAAAGCGGATTCAATTTTGTCAGATAA
AGTCTTTTATCAAATCGGCGGCGGTGTCGGTTATATGGCGCCACCGACAAGATCGAATACGATTAATGCG
GCAGAATTCGGTATCGGTTGGAAAGCAAATTTGATGTGCGGTAATTTTGACATCAAGACGACGATTAAAA
ACCAGCTAAACGGCATAACCGAAGGGTTTAAGGATTTATACAGTAATGTTATTGAGTCCGCTACCGGCGC
CGTAGCTAGTCTTCCGGCCATGATCATTCAGCGCGCTAATCCTCAACTCTATGATATTTTAACCAACGGA
CTCTATCAGGGAAAAATTGACTTTGCCAATTTAAAAACCAACTGTGAAGAAATGTCTAAACGACTGGCCG
ATGCAACGCTAGATGGACGTTGGTCGGCAAGTGCGGACATGGAGAAATATAAGATGCTACTGACGTCCGA
ACCTGATGCGAATAAAGTGCAGAAGCAACTGGAAGATAATAAAGGTAAGGCCGGTAAAACTTGGGTAGGT
AACCAACCGAAAGGTGGTGAGGGTCAAGAACCAATCAAATTGGTTGAGGATGTGGCAACTGCCGGTTATA
ACATACTCAATAATCGCCCGGTGTTAGAAAAAAAGCCGATTTCCGGTTCTAATTGTAGTGGACTACTTTG
TCAAACGTGGGAAGATCCAAAGCAGCTTTCAGAATGGCTCACGAAAGTCGTTGGTGAACAAACCTTATCA
ACTTGTGTGGAGAATTGCGGTACACCAACAAGTTCAAAACCCGGTGTCGGACTAACGCCGGAAATTGAAG
AAGAGAATATACGGACATTATCCAATCTTGAAAAAGCACTGAATATGCCGGTGCCTCCGCCGGAGGTGTT
GGCACAGTTGAGTTCAAATACCATTCCGGTAACAAGGGGGCTAATCGAAGCACTCCGCGAAGATCCGGAT
GTGGAGTTATTAAGTCAACGTCTAGCCAGCGAACTGGCGCTTTCAAAGAGCATGGAAAAAATGCTATTAG
CGCGCCGTTCAATTCTTGCCGGTATGCGTGAGCCAAACGTGATCAACAATAAGGACGCAACAGACGAACT
GGAAAAAATATTAAACGTGATTGATCGGGAAATCGAGCAAATTAATATGGAGACCAGCCTACAGAAAAGC
ATTACCGGCAACACGGCATCGGCAATCTTACAAAATAAAGAACGTCGTGATATTAATTCCGGCTCACATG
GTTTGCAGCAAGACAGTTTGGATAAACGGCTTAATCAGTTAACCAATGGTACATTCCAAAATGAAACGGA
TACTATCGATCCAAATGACATCAATATTCAACGTAAACCTATAGTGCTAGGCGTACCAAGTGTTGCAAGT
TCCGGCACTGTGGCTCGTCCTTCTTTCGGTGGCAGTGGCGGAACCAGTACCGCCGGTAATCCGAATGTCA
ATGTGCCAAATAACCAAATTACGGCCAAGAGTAAAAAAGAATTTATTCAACAGGCGATGCCGATAGCAAA
AGCTATTGAAGAAAAATGGGGCGTGCCGGCTGAAGTGGTGATTGCACAAGCAGCACTGGAATCCGGTTGG
GGTAAACATGTGAAAGGTAATGCGTACTTTGGTATTAAGGGCAAAGGTAGCCAAGGTTCAATCAATTTTG
GTACGCATGAGGTAATTAACGGTAAGAAAATCAGTATCAATGATAACTTCGCCTCGTATGGCGGGTTCGG
AGATGCAGCAAACGGCTATGGTGAATTCTTAAATAAAAATAAGCGTTATCGTGAAGCATTTAAACACAAA
GATAATCCGGTAGAATTTGCAAAAGCGATAGCACGTGCCGGTTATGCAACCGATCCGGATTATGCAAATA
AGTTGACAAAAATCATTCAATCAAATAAATTTTCATAA
 Primer design