SecReT4
Protein ID: 33152065
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0924
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]738977..739444 [+]
Producthypothetical protein
Component typeTfc20
UniProt IDQ7VMP9
KEGG IDhdu:HD0924
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 155 a.a.     [Download]
>gi|33152065|ref|NP_873418.1| hypothetical protein HD0924 [Haemophilus ducreyi 35000HP]
MFNRVERLFIFLPQRPRKLLLIALMVAGLPFFLVAFLLFRAWLYRDVSLDERGEIFYPTNQTQQVIEELQ
SINRNLTNLKGNNTFGVGSRVAFVAGRGQSEKNIFSENDDNELWEVDSADNDTWETDYSLNRGDLGNPYY
YDDSEAGKANNVWGE
 
Nucleotide Sequence: 468 bp     [Download]
>gi|33151282|ref|NC_002940.2|:738977-739444 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGTTTAATCGTGTTGAGCGGTTATTCATATTCCTTCCGCAACGGCCTAGAAAGCTTCTTTTAATTGCGT
TGATGGTTGCAGGGCTGCCTTTCTTTTTGGTCGCGTTTTTATTGTTTCGTGCGTGGTTATATCGAGACGT
CTCTTTAGATGAACGCGGTGAGATTTTCTACCCAACCAACCAAACTCAGCAAGTAATCGAAGAGCTACAA
AGTATCAATCGTAATCTGACAAATTTAAAGGGTAACAATACCTTTGGGGTCGGAAGCAGAGTAGCATTCG
TGGCAGGACGAGGGCAGAGCGAAAAAAATATCTTCTCCGAGAATGATGACAATGAACTGTGGGAAGTGGA
TTCTGCTGACAACGATACTTGGGAAACGGATTATTCCTTAAATAGAGGCGATCTAGGAAACCCATATTAC
TATGATGATAGCGAAGCGGGAAAAGCTAATAATGTTTGGGGCGAATAA
 Primer design