SecReT4
Protein ID: 33152067
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0926
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]739493..739924 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ7VMP7
KEGG IDhdu:HD0926
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.6e-30, Aligned region: 1..124
Protein Sequence: 143 a.a.     [Download]
>gi|33152067|ref|NP_873420.1| hypothetical protein HD0926 [Haemophilus ducreyi 35000HP]
MVQAFLIMVVIILTPVIIILSAYSLKTVITLTFVHFALITLSFWWELARWLDSALLDILYNSPAHKRINP
FFLENTQDDIIVNFVMGSLFVVLPALWFTSMSWAGVTVGNIAQSLANGAKHAQNSGEKGFGASKRAIDTV
TKK
 
Nucleotide Sequence: 432 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c739924-739493 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGGTACAGGCATTTTTAATTATGGTCGTCATTATTCTCACCCCGGTCATCATTATTTTAAGTGCCTATT
CGTTAAAGACGGTGATTACGCTCACGTTTGTACATTTTGCGCTTATTACGTTGTCGTTTTGGTGGGAGCT
GGCAAGATGGTTAGACTCGGCATTGCTTGATATTCTGTATAATTCACCGGCACACAAGCGTATTAATCCG
TTCTTTTTAGAAAATACGCAAGATGACATCATTGTGAACTTTGTGATGGGTAGTCTGTTTGTTGTCCTGC
CGGCACTGTGGTTTACTTCGATGAGTTGGGCAGGAGTAACAGTAGGAAATATAGCTCAATCACTGGCAAA
TGGAGCAAAACATGCTCAAAACAGTGGAGAGAAGGGTTTTGGTGCATCAAAGAGAGCAATCGATACAGTG
ACCAAGAAATAA
 Primer design