SecReT4
Protein ID: 33152068
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0927
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]740037..740180 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ7VMP6
KEGG IDhdu:HD0927
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|33152068|ref|NP_873421.1| hypothetical protein HD0927 [Haemophilus ducreyi 35000HP]
MRQNLSAQVSDFFNSVDNQDEALLRTLLRAENMEVSHGKVYPGYGRW
 
Nucleotide Sequence: 144 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c740180-740037 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGCGACAAAACTTATCGGCACAAGTCAGTGACTTTTTTAATTCGGTAGACAATCAAGATGAAGCGTTAC
TAAGAACCTTGTTACGCGCAGAAAATATGGAAGTCTCGCACGGAAAAGTTTATCCCGGCTACGGTCGGTG
GTAA
 Primer design