SecReT4
Protein ID: 33152069
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0928
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]740201..741004 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ7VMP5
KEGG IDhdu:HD0928
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-50, Aligned region: 10..259
Protein Sequence: 267 a.a.     [Download]
>gi|33152069|ref|NP_873422.1| hypothetical protein HD0928 [Haemophilus ducreyi 35000HP]
MTFYTDSYLEYFLTLLGWIINNGIFSVFVGTGLWILPLIILMFKIWLDVGKQGDDEGEKGDLLIRWLYLN
LIPAMFVVVLVLAPTIPISLDNIGFNVERSKQCGYKVPLEPSKTGYGNYIESTFGGKQARVPLWWALMHK
FNKGLTHAFASTIPCQIDLRQVRFEVQHEKINNPALFTELQQFTQQCYIPARRKVQESQVNLTEAQVRET
SWLGGKLLIKNSELYPRYRAQQPNKLFPYDSNRDAGLPNNGDGGYPTCSGGTVHKPA
 
Nucleotide Sequence: 804 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c741004-740201 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGACGTTTTATACCGACAGCTATTTAGAATATTTTTTAACGCTACTGGGTTGGATTATCAATAACGGTA
TTTTCTCCGTGTTTGTCGGCACCGGGCTTTGGATATTACCGCTCATTATTCTCATGTTCAAAATCTGGTT
AGACGTAGGCAAACAAGGAGATGATGAGGGGGAGAAAGGAGATCTATTGATCCGTTGGCTTTACCTTAAT
CTGATCCCGGCAATGTTTGTGGTCGTGCTTGTTCTTGCACCAACCATTCCGATTTCGCTGGATAATATCG
GGTTTAATGTGGAGCGCTCCAAACAATGCGGTTACAAGGTTCCGCTTGAACCGAGTAAAACCGGTTATGG
AAATTATATTGAATCCACTTTCGGTGGTAAGCAGGCAAGGGTCCCGCTTTGGTGGGCATTGATGCACAAA
TTTAACAAGGGATTGACACATGCGTTTGCCTCTACCATTCCTTGTCAAATAGACTTGCGTCAAGTGCGCT
TTGAAGTACAGCATGAAAAAATCAATAATCCGGCATTATTTACCGAACTTCAGCAATTTACTCAGCAATG
TTACATTCCGGCACGACGCAAAGTACAAGAAAGTCAAGTGAACTTAACTGAAGCGCAAGTCCGTGAAACC
AGTTGGCTCGGCGGAAAACTGCTGATTAAAAACAGTGAACTTTACCCACGCTATCGGGCACAACAACCTA
ACAAACTGTTTCCTTATGATAGCAATCGTGACGCCGGGTTACCCAATAACGGAGACGGCGGCTACCCAAC
TTGCAGTGGTGGGACAGTGCACAAGCCGGCTTAA
 Primer design