SecReT4
Protein ID: 33152070
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0930
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]741017..741349 [-]
Producthypothetical protein
Component typeTfc18
UniProt IDQ7VMP4
KEGG IDhdu:HD0930
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|33152070|ref|NP_873423.1| hypothetical protein HD0930 [Haemophilus ducreyi 35000HP]
MMVNNPSKSNTSRRRLKFMLGFVIIPIATLIGLALLGQFIATYLPGINLQQWFHETRLIWFVVRLGFYAL
VIVLMVKINQKSKTAIPKTARWLIIAILIFAEAISNITLA
 
Nucleotide Sequence: 333 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c741349-741017 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGATGGTAAACAATCCTAGTAAATCAAACACCTCTCGTCGCCGTTTAAAATTTATGCTGGGTTTTGTCA
TTATCCCGATCGCAACACTCATCGGTTTGGCGTTACTCGGACAATTTATTGCGACCTATTTACCCGGCAT
CAATTTGCAACAATGGTTCCATGAAACACGCCTTATTTGGTTTGTTGTACGTTTAGGATTTTATGCGCTG
GTCATCGTGCTGATGGTAAAAATCAACCAAAAAAGTAAGACGGCCATTCCTAAGACAGCCAGATGGCTCA
TCATCGCTATACTGATTTTTGCCGAAGCAATTAGTAACATTACGCTTGCCTAG
 Primer design