SecReT4
Protein ID: 33152071
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0931
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]741330..741785 [-]
Producthypothetical protein
Component typeTfc17
UniProt IDQ7VMP3
KEGG IDhdu:HD0931
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 151 a.a.     [Download]
>gi|33152071|ref|NP_873424.1| hypothetical protein HD0931 [Haemophilus ducreyi 35000HP]
MTIQQISQPNMISYARLFEIGPRVQSLKFVTENIQKNLVSFADKIKRKVGQHCNIIAYPHRVFNLASWKV
HISGAQSELHFLVNVSGRFALPAFDEQHWPARLNIDIADHVDAFWFIQFLGQQLSAKSLSPLSTKIGDNS
VYSEANDGKQS
 
Nucleotide Sequence: 456 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c741785-741330 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGACGATACAGCAAATATCGCAGCCTAATATGATAAGTTACGCCCGTTTATTTGAGATTGGTCCGCGTG
TTCAATCGTTAAAATTTGTCACCGAAAACATCCAAAAAAATCTGGTTAGCTTTGCCGATAAAATTAAACG
TAAAGTCGGCCAACATTGCAACATTATTGCCTACCCGCATCGAGTTTTTAATCTGGCCAGTTGGAAAGTG
CATATTTCCGGTGCGCAAAGCGAACTGCACTTTTTAGTCAATGTTTCCGGGCGCTTTGCATTACCGGCGT
TCGACGAACAACATTGGCCGGCCAGACTCAATATTGATATTGCCGATCATGTTGACGCGTTCTGGTTTAT
TCAATTTCTAGGACAACAGCTATCAGCGAAATCCCTTTCTCCGTTATCCACAAAGATTGGGGATAATTCT
GTGTATAGTGAGGCGAATGATGGTAAACAATCCTAG
 Primer design