SecReT4
Protein ID: 33152072
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0932
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]741757..742149 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDQ7VMP2
KEGG IDhdu:HD0932
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 130 a.a.     [Download]
>gi|33152072|ref|NP_873425.1| hypothetical protein HD0932, partial [Haemophilus ducreyi 35000HP]
MTDFPDNADKLLSMIEWWELLNLSNDEVEEVNRFRRLTEAQKLMLLSAKKADKKYTEGVVLATNMEALFR
VVPPSLFLALGMTEKHEKAQRKQLMMAHNCSELDAALMVAQDLDRKRGIAANDDTANIAA
 
Nucleotide Sequence: 393 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c742149-741757 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGACCGATTTCCCGGATAATGCGGATAAATTGCTCAGCATGATCGAATGGTGGGAATTACTCAACTTAT
CCAATGATGAAGTTGAAGAGGTCAATCGATTCCGACGGTTAACCGAAGCACAAAAACTGATGTTGCTCTC
GGCGAAGAAAGCCGACAAAAAATACACGGAAGGCGTGGTATTGGCAACCAATATGGAAGCGCTGTTTAGA
GTGGTACCGCCAAGTCTATTCTTAGCACTCGGTATGACCGAAAAACATGAGAAAGCACAACGCAAGCAAT
TAATGATGGCGCACAATTGTAGTGAATTAGATGCCGCTCTCATGGTTGCACAAGATTTAGATAGAAAACG
GGGGATTGCAGCTAATGACGATACAGCAAATATCGCAGCCTAA
 Primer design