SecReT4
Protein ID: 33152073
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0933
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]742130..744538 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDQ7VMP1
KEGG IDhdu:HD0933
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.7e-69, Aligned region: 68..337
AAA_10 [PF12846], Evalue: 1.6e-17, Aligned region: 531..776
Protein Sequence: 802 a.a.     [Download]
>gi|33152073|ref|NP_873426.1| hypothetical protein HD0933 [Haemophilus ducreyi 35000HP]
MSLLQDVIQSFFPAKEKIRSAKVIEAETLKTHATVQSVDEITPQFGAIPRRSGKVTQSQHNRKLYSTAPS
FVDHLPYAEYLDNEGVMLLDDGKSVGAVFEVKPIGTEGRSEDFLNRVRTLVKDALQDSFDELDNNPYVVQ
FYCQDEKDLSGYVTHVRDYIRQVSPDAYGSVFTEQWLSEIERHLKNVTKPGGLFVDNRVTNTAWAGKIRR
TRLVIYRYVGNNENDVIVQLNNACERLSSAFVTAGLTLYRQNGKQIHDWLLRWFNPKPSNNFQGLDDKAC
YDLLTYPEQEENEMPLAWQDFSENLFYSQPESKGEHWYFDNQPHEVIVVDSIRKEPKVGHMTGEVTRGRN
INALFDLLPESTIMVTTIVVHPQDHLQNRLDTLSSRAVGKGYDSVYLKQDAITVTQYLKDGHKLYHGALA
FYIHGKDRDELRDRARELRTILLSNNLVPVKEGSEVAPLNSYLRWLPMNFNPQYDAKSHNYTKYYWVQHL
ANMLPVFGRETGTGHPGITYFNRGGTPFDFDPLNPKDRTKNAHKLILGPTGSGKSATLTAQISQLMAVHR
PRLFIVEAGNSFGLFADYAERYGLTVNRVSLEPSSDIVLPLFSEAHKLLEMDVTIEVDDNEDEEDNDGEE
QRDLLAEMELTARLMITGGETKEDDKMSRADRSAIRQAILLAARKTLQEQRQVLTGDVKAALEELSQDEN
TRPERRVRLAEMAEAIDMFCNGVNGRFFNREGEIWPEADITLVDLAMFAREGYEAELAIAYISLINHINS
LGEKYQHSFRPIVNITRDLALAGYAKYDRFPG
 
Nucleotide Sequence: 2409 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c744538-742130 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGTCCTTATTACAAGATGTTATACAATCGTTTTTCCCCGCTAAAGAAAAAATACGAAGTGCAAAGGTTA
TTGAAGCGGAGACGTTAAAAACTCACGCAACCGTTCAATCTGTTGATGAAATCACGCCGCAATTCGGCGC
AATACCGCGCCGCAGTGGGAAAGTCACACAATCTCAGCATAACCGAAAATTGTACAGTACCGCCCCGTCT
TTTGTCGATCACCTGCCTTATGCCGAATATTTGGATAACGAAGGCGTGATGTTACTTGATGACGGCAAAA
GCGTTGGTGCGGTCTTTGAAGTCAAGCCTATCGGTACGGAAGGACGTAGTGAGGATTTTCTAAATCGAGT
ACGCACATTAGTCAAAGACGCCTTGCAAGATAGCTTTGATGAGCTTGATAACAATCCTTACGTCGTGCAG
TTTTACTGCCAAGATGAAAAAGATTTAAGCGGTTATGTCACGCATGTACGCGACTATATTCGCCAAGTCT
CACCGGACGCATACGGTAGCGTATTTACCGAGCAATGGTTATCCGAGATAGAAAGACACTTAAAAAATGT
CACCAAACCCGGCGGATTATTTGTTGATAACCGGGTAACGAATACCGCTTGGGCCGGCAAAATACGCCGA
ACCCGTTTAGTCATTTATCGTTATGTCGGTAATAACGAAAACGATGTAATCGTCCAACTCAATAATGCCT
GTGAACGCTTAAGTAGTGCCTTTGTGACTGCAGGTCTTACCCTGTATCGACAAAACGGAAAACAAATCCA
TGACTGGCTATTACGCTGGTTTAATCCGAAACCGTCAAACAATTTTCAGGGATTGGATGATAAAGCCTGT
TACGATTTATTGACCTATCCCGAACAAGAAGAGAATGAAATGCCGTTGGCATGGCAAGATTTTAGTGAAA
ACCTCTTTTATAGCCAACCGGAAAGTAAGGGGGAACATTGGTATTTTGACAACCAACCGCATGAAGTGAT
TGTGGTCGACAGTATCCGCAAAGAGCCGAAAGTCGGACATATGACCGGTGAAGTCACGCGCGGACGTAAT
ATTAATGCGTTATTCGATTTATTACCCGAATCAACCATTATGGTGACTACGATAGTGGTACATCCGCAAG
ATCATCTGCAAAATCGCTTAGATACGCTCAGTAGTCGTGCGGTAGGTAAAGGCTATGATTCGGTCTATTT
AAAGCAAGATGCCATCACCGTCACCCAATATTTAAAAGACGGACACAAGTTATATCACGGTGCACTTGCC
TTCTACATCCATGGCAAAGACAGAGATGAATTAAGAGATCGCGCCCGTGAACTACGCACCATCTTACTAA
GTAATAACTTGGTGCCGGTCAAAGAAGGTTCGGAAGTCGCCCCGCTTAATAGCTACCTACGTTGGTTGCC
AATGAACTTCAATCCTCAATATGATGCCAAATCACATAATTACACCAAGTATTACTGGGTACAGCATCTT
GCCAATATGTTACCGGTCTTCGGACGGGAAACCGGCACCGGTCATCCCGGTATTACCTATTTTAATCGAG
GTGGAACGCCATTTGATTTCGATCCGTTAAATCCAAAAGACCGAACCAAAAATGCACACAAGCTGATTTT
AGGTCCAACCGGTTCCGGTAAATCGGCAACCCTTACCGCTCAAATATCGCAGCTTATGGCAGTGCATCGC
CCACGCCTTTTTATTGTCGAAGCCGGTAACTCTTTTGGACTGTTTGCCGACTATGCCGAACGCTACGGCT
TAACCGTCAATCGGGTATCACTCGAACCAAGCAGTGATATCGTTCTTCCACTTTTTTCCGAAGCGCATAA
GTTATTGGAAATGGATGTGACCATCGAAGTGGATGACAATGAGGACGAAGAAGACAACGACGGCGAAGAA
CAACGTGATTTACTTGCGGAAATGGAATTAACCGCAAGACTCATGATCACCGGCGGTGAAACGAAAGAAG
ACGATAAAATGAGCCGAGCCGACCGTTCGGCTATCCGCCAAGCAATCTTACTGGCGGCTAGAAAAACCTT
GCAAGAGCAACGTCAAGTACTCACCGGCGATGTGAAAGCCGCCTTAGAGGAATTAAGCCAAGATGAAAAT
ACCCGCCCAGAACGACGTGTCCGCCTAGCAGAAATGGCAGAAGCCATAGATATGTTTTGTAATGGCGTAA
ACGGGCGTTTTTTCAATCGTGAAGGTGAAATTTGGCCCGAAGCCGACATCACCCTTGTTGATTTGGCGAT
GTTCGCACGTGAGGGATATGAAGCAGAATTGGCGATTGCGTATATTTCATTAATTAACCATATTAACTCG
CTTGGTGAAAAGTACCAGCACAGTTTTCGTCCAATCGTCAATATTACCAGGGATTTGGCTCTGGCTGGCT
ACGCAAAATATGACCGATTTCCCGGATAA
 Primer design