SecReT4
Protein ID: 33152074
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0934
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]744538..744945 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDQ7VMP0
KEGG IDhdu:HD0934
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|33152074|ref|NP_873427.1| hypothetical protein HD0934 [Haemophilus ducreyi 35000HP]
MNYSTIGIIAISLGLITACSTSKNDLLPSSTTMQDIWNKGGGNSNQLQAYRNDGGQRMIEPPKYLSTQEQ
KSYTRTVENEVSNLFPRLPNPDLIMYVYPHLSASGEPTPIPGYTSVIPFYGRVQYAQPGERTRGL
 
Nucleotide Sequence: 408 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c744945-744538 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGAATTACTCAACCATTGGTATCATTGCCATCAGTCTTGGTCTTATAACGGCGTGTTCAACGTCCAAAA
ACGACTTACTTCCGTCTTCAACAACTATGCAAGATATTTGGAATAAAGGCGGCGGAAACAGCAATCAATT
ACAAGCATACCGCAATGACGGCGGGCAACGGATGATTGAGCCGCCGAAATATCTCTCTACCCAAGAGCAG
AAAAGTTATACCCGCACGGTGGAAAATGAAGTGTCCAATCTGTTTCCAAGATTGCCGAATCCCGATCTGA
TTATGTATGTGTACCCGCATCTTTCCGCATCAGGCGAACCGACGCCGATTCCGGGCTATACCTCGGTTAT
TCCGTTTTACGGACGGGTACAATATGCCCAACCCGGTGAACGCACCAGGGGATTATAA
 Primer design