SecReT4
Protein ID: 33152075
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0935
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]744962..746407 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDQ7VMN9
KEGG IDhdu:HD0935
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6e-07, Aligned region: 275..459
Protein Sequence: 481 a.a.     [Download]
>gi|33152075|ref|NP_873428.1| hypothetical protein HD0935 [Haemophilus ducreyi 35000HP]
MQANKGFYVVIAIVIFAMGLMSWFLFGGSGTDSTPSRSQQKAFLDTSLKDLSPDTLRAMGIEGDTPNDTV
RTLIGKSKANEKLINEVISKNEKLIAETSRLQKKQDDVDYQIQQAVQSEAGALVDELQTLKNEILQLKDS
TQKQAASVIGNNGSNEALPINGATNAGGDTTTDNNTVRWVTPSDQIAMDDKGNLLPLGNIGTSSNAKFGF
PVDFKPKSSPDTPNSVKTQPFSEENNSVTAKKGKEVPFFTIAPNSTLTNSVAMTALVGRVPIGNNVTEPY
PFKLLIGRDNLIANGIELPDIEGAIVSGTATGDWTLSCVRGDVKSLTFVFTDGRIVSTDSGDSKSGENIG
WLSDPYGIPCIQGTRKTNAPEYLGTNFLLAGASAAAQGMAQSQTTTVVDGNAVIGAVTGNNGKYILGQAL
GSGLKDTADWFRQRYGQTFDAVYVPPGQEVAVHINKEIKIDYSTGGRKVKYGQSSRTSALD
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c746407-744962 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGCAAGCAAATAAAGGGTTCTACGTTGTTATTGCAATCGTCATCTTTGCCATGGGGCTAATGTCATGGT
TTTTATTCGGCGGTTCCGGTACCGATTCAACACCCTCACGATCACAACAAAAAGCATTCCTTGATACGTC
ACTTAAAGACTTATCACCGGACACGTTACGCGCAATGGGCATCGAAGGTGATACACCAAATGATACGGTC
AGAACCTTAATCGGTAAATCTAAGGCAAACGAGAAGCTCATTAATGAAGTTATTTCAAAAAATGAGAAAT
TAATTGCAGAAACCTCTCGACTACAGAAAAAACAAGACGACGTAGACTATCAAATTCAACAAGCCGTACA
ATCTGAAGCCGGCGCCCTTGTTGATGAATTACAAACACTAAAAAATGAAATTTTACAATTAAAAGATTCC
ACCCAAAAACAAGCCGCGTCAGTCATCGGAAATAACGGTAGTAATGAGGCATTGCCGATTAACGGTGCCA
CAAATGCAGGTGGTGATACGACAACAGATAACAATACGGTTCGTTGGGTTACGCCAAGCGACCAGATCGC
CATGGACGACAAAGGAAATTTGCTGCCCCTTGGCAATATTGGTACATCCTCTAATGCAAAGTTCGGTTTT
CCTGTTGATTTTAAGCCAAAATCCTCGCCAGATACGCCAAATTCAGTCAAAACACAACCATTCTCTGAAG
AGAATAATTCGGTGACGGCAAAAAAAGGAAAAGAAGTCCCTTTCTTTACCATTGCACCGAACTCGACATT
AACCAATTCCGTTGCCATGACCGCACTCGTCGGTCGTGTGCCGATAGGTAATAATGTCACGGAACCCTAT
CCGTTTAAACTGCTTATCGGACGAGACAATCTCATTGCTAACGGTATTGAACTGCCGGACATTGAAGGCG
CCATCGTATCCGGTACCGCAACCGGCGATTGGACGCTTTCTTGTGTGCGCGGAGATGTGAAAAGCTTAAC
TTTTGTCTTTACCGACGGACGTATCGTCTCTACCGATTCCGGTGACTCAAAATCCGGCGAGAATATCGGT
TGGTTATCCGACCCGTATGGTATCCCGTGTATCCAAGGAACGCGCAAAACCAATGCGCCGGAATACCTGG
GCACAAACTTCCTACTTGCCGGCGCCTCAGCCGCTGCGCAAGGTATGGCACAATCCCAAACCACGACGGT
TGTCGATGGAAACGCCGTGATTGGTGCCGTGACCGGTAATAACGGCAAATACATTTTAGGACAAGCCCTC
GGCTCCGGATTAAAAGATACCGCCGACTGGTTTCGTCAGCGTTACGGTCAAACGTTTGATGCCGTTTACG
TTCCGCCGGGGCAGGAAGTTGCCGTACATATCAATAAAGAAATCAAAATCGATTACAGCACCGGCGGTCG
TAAAGTCAAATACGGTCAATCCTCTCGAACCTCAGCATTAGATTAA
 Primer design