SecReT4
Protein ID: 33152076
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0936
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]746420..747280 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDQ7VMN8
KEGG IDhdu:HD0936
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.6e-116, Aligned region: 1..275
Protein Sequence: 286 a.a.     [Download]
>gi|33152076|ref|NP_873429.1| hypothetical protein HD0936 [Haemophilus ducreyi 35000HP]
MKKMILFVGASLLLSNVASAEILLKWDRKPLPIELQVKEERIVFADKNVKVGYPAQLEGKLRMQSSGGAV
YFTALAEFPKSRLQLVDLATGELILLDVEAKPHIPNANEPIRLVYTDKVEKQSTVFNQDSGEEADLKNVK
PQLPVPAALTRYAAQMFYAPLRTVEPLEGVRQVAHRLPNKITTLLPAYPIQATPLLSWQLENFVVTAIRL
QNRGSSHIELDPRELQGRFYAATFQHGWLGGHGSPEDTTTLYLVTEGYANQALIPETHQYKTRKLKKVTT
TTTVIK
 
Nucleotide Sequence: 861 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c747280-746420 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGAAAAAGATGATTTTATTCGTAGGAGCCTCATTACTCCTCTCCAATGTAGCCTCGGCAGAAATCCTAT
TGAAATGGGATCGCAAGCCATTACCCATTGAACTACAAGTCAAAGAAGAGCGAATCGTCTTCGCGGATAA
AAATGTGAAAGTGGGCTACCCGGCGCAATTAGAGGGCAAATTACGTATGCAATCTAGCGGCGGTGCTGTT
TATTTTACCGCATTAGCCGAATTCCCGAAATCCCGCTTGCAATTGGTTGACCTGGCTACCGGTGAGCTAA
TTTTACTTGATGTAGAAGCAAAACCTCATATACCGAATGCAAATGAACCGATACGTCTTGTTTATACCGA
TAAAGTCGAAAAACAATCTACCGTCTTTAATCAAGATAGCGGTGAGGAGGCTGATTTAAAAAATGTTAAG
CCGCAATTACCGGTACCGGCGGCACTAACCCGCTACGCAGCACAAATGTTCTATGCACCGCTACGTACGG
TTGAACCGTTAGAAGGCGTGCGACAAGTCGCTCACCGCTTACCGAATAAAATTACCACGTTATTGCCGGC
TTATCCGATTCAAGCCACGCCACTTCTTAGTTGGCAATTAGAAAACTTTGTTGTCACGGCAATTCGCCTG
CAAAACCGGGGGAGCAGTCATATCGAACTTGACCCAAGAGAATTACAAGGGCGATTCTATGCCGCTACGT
TTCAACACGGTTGGTTGGGAGGGCATGGTTCACCGGAAGATACCACAACACTTTATTTAGTAACGGAAGG
CTATGCCAACCAAGCGCTGATCCCGGAAACTCATCAATATAAAACAAGAAAACTGAAAAAAGTGACAACC
ACGACAACCGTCATTAAATAA
 Primer design