SecReT4
Protein ID: 33152077
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0937
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]747344..747919 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDQ7VMN7
KEGG IDhdu:HD0937
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 5.9e-74, Aligned region: 7..187
Protein Sequence: 191 a.a.     [Download]
>gi|33152077|ref|NP_873430.1| hypothetical protein HD0937 [Haemophilus ducreyi 35000HP]
MSKLKGAINQAKREVFTARLAIGALFIICLALSVVIYTLPRSFTIYNPPDLRLGSQRSIWDVPPSTVYAF
AYQTFQQLNRWVINGEENYKENIETLRPLITPGCQQFLEKDYYDRLSNGELKERTRGVYEIIGRGFSNER
VIIHSQDSWTVNLDLNVDEFFKDEKVKKTLTRFPISIVKMDVDAKNPGIRI
 
Nucleotide Sequence: 576 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c747919-747344 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGAGCAAACTAAAAGGTGCGATTAATCAAGCAAAAAGAGAAGTGTTTACCGCACGCTTAGCAATTGGAG
CACTATTTATTATCTGTCTGGCATTAAGTGTCGTGATCTACACCTTACCGCGTAGCTTTACGATATATAA
CCCACCGGATTTACGTTTAGGTAGCCAACGTTCTATTTGGGATGTGCCACCGTCCACGGTTTACGCATTT
GCCTATCAAACCTTCCAACAGCTTAACCGTTGGGTAATAAACGGGGAAGAAAATTACAAAGAAAATATTG
AAACCCTTAGACCGTTAATTACACCGGGTTGTCAGCAATTTCTAGAGAAAGATTATTACGACCGGTTGAG
TAACGGCGAGTTAAAAGAGCGTACACGCGGCGTTTATGAAATTATTGGGCGGGGTTTTAGTAATGAGCGC
GTCATCATTCATAGCCAAGATAGTTGGACGGTCAATCTGGATTTAAATGTCGATGAGTTTTTTAAAGACG
AAAAAGTGAAAAAGACCCTAACCCGTTTCCCGATTAGTATCGTGAAAATGGACGTGGATGCTAAAAATCC
GGGGATTAGGATTTAA
 Primer design