SecReT4
Protein ID: 33152078
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0938
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]747931..748305 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ7VMN6
KEGG IDhdu:HD0938
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 7.2e-42, Aligned region: 6..122
Protein Sequence: 124 a.a.     [Download]
>gi|33152078|ref|NP_873431.1| hypothetical protein HD0938 [Haemophilus ducreyi 35000HP]
MPNEREQTIPFLPNRLNKEATVFGGMSMTEFFTVATIGFVIGAILGLLVVLLLGIDYWLFIPALAMLLCI
CVVLIGKTLIARLKRGKPEGYLNRVLEVKLSNLLGSNQFIAYEGHWSIRRQRKK
 
Nucleotide Sequence: 375 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c748305-747931 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGCCAAATGAAAGAGAACAAACCATTCCTTTTTTGCCCAATCGATTAAACAAAGAAGCCACCGTTTTCG
GCGGTATGTCCATGACGGAATTCTTTACGGTTGCGACCATCGGCTTTGTGATTGGGGCCATTCTTGGTCT
CCTCGTTGTATTGCTGTTAGGCATCGATTATTGGCTATTTATTCCGGCATTAGCCATGTTGTTATGTATC
TGCGTCGTATTAATCGGCAAAACACTGATTGCCCGCTTAAAACGCGGTAAACCGGAAGGTTACTTAAATC
GCGTACTGGAAGTAAAACTGAGCAATTTACTCGGTAGCAATCAGTTTATTGCTTATGAAGGCCATTGGTC
CATTCGTCGACAACGCAAAAAATAA
 Primer design