SecReT4
Protein ID: 33152079
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0939
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]748323..748712 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDQ7VMN5
KEGG IDhdu:HD0939
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 2e-26, Aligned region: 39..127
Protein Sequence: 129 a.a.     [Download]
>gi|33152079|ref|NP_873432.1| hypothetical protein HD0939 [Haemophilus ducreyi 35000HP]
MKHIKSCLTFLSKHYLAFSVLLFGSIQNAFATGIDTGKIPDFKIPGVDNNTKDPIQIVYIVGKALVALAA
VLFSAWAIFNVVKALIKTYNDATDDNSKKGWGPFIAALIIGFVVIFFCLYLVKLAIGLF
 
Nucleotide Sequence: 390 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c748712-748323 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGAAACACATTAAATCCTGCTTAACGTTTCTTTCCAAACATTATCTTGCCTTTAGCGTACTACTGTTTG
GCTCAATACAAAATGCATTCGCTACCGGTATTGATACCGGAAAAATTCCGGATTTTAAAATTCCCGGTGT
GGATAACAATACCAAAGATCCGATTCAAATCGTCTATATCGTAGGTAAAGCGCTCGTTGCTTTAGCAGCG
GTTCTCTTCTCTGCTTGGGCAATCTTTAACGTTGTAAAAGCACTCATTAAAACCTATAACGATGCGACCG
ATGACAACTCTAAAAAAGGTTGGGGACCATTTATTGCCGCACTTATTATCGGCTTTGTCGTCATCTTCTT
CTGCTTATACCTCGTTAAATTGGCTATCGGCTTATTCTAA
 Primer design