SecReT4
Protein ID: 33152080
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0940
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]748972..749298 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ7VMN4
KEGG IDhdu:HD0940
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.9e-28, Aligned region: 20..102
Protein Sequence: 108 a.a.     [Download]
>gi|33152080|ref|NP_873433.1| hypothetical protein HD0940 [Haemophilus ducreyi 35000HP]
MPRNKRGKSLFILCGCLGMTMLAQATEQEQLEQAIKQMDAAKLSLQRAAQQAKTSVKSREFFDYTAAQRD
ITTVQEGIKQYINPSRAIPRNPKAVRALTEDYTKLREQ
 
Nucleotide Sequence: 327 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c749298-748972 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGCCAAGAAATAAACGAGGCAAGTCCCTATTCATACTTTGCGGATGTCTCGGCATGACAATGCTTGCGC
AGGCAACCGAACAGGAACAACTTGAGCAAGCCATTAAGCAAATGGATGCCGCCAAATTATCCCTGCAACG
CGCCGCACAACAAGCCAAAACCTCGGTAAAAAGTCGAGAATTTTTTGATTATACCGCTGCACAACGTGAC
ATCACCACCGTGCAGGAAGGGATCAAACAATATATCAATCCGTCTCGTGCCATACCGCGCAATCCGAAGG
CAGTGCGTGCACTGACGGAAGATTATACGAAACTAAGGGAGCAGTAA
 Primer design