SecReT4
Protein ID: 33152081
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0941
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]749465..750151 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ7VMN3
KEGG IDhdu:HD0941
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.8e-65, Aligned region: 38..225
Protein Sequence: 228 a.a.     [Download]
>gi|33152081|ref|NP_873434.1| hypothetical protein HD0941 [Haemophilus ducreyi 35000HP]
MSEQVPVKKKKGPCHYINALFAALFISLFLSIIFEWLGIAFIWTDEGHLHSQQMMIKELGWLSEDLTQGI
ASRSPKELAEELILTLNHWLFVKTGLRGWLDNPAQHNSWELWIYHYARAYIESVIYVSITFVIRLIVIVF
SSPLFLLAAFAGLTEGMMMRDLRKFGAGRESSFVYHHARRLIGPVMIGAWIFYLSIPVSIYPNLVLMPAA
FLFGLSICVTFASFKKYL
 
Nucleotide Sequence: 687 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c750151-749465 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGTCTGAACAAGTACCGGTTAAAAAGAAAAAGGGACCTTGCCATTACATCAATGCGCTTTTCGCCGCAC
TTTTTATCTCACTATTCTTGAGTATTATTTTTGAATGGCTGGGAATCGCTTTTATTTGGACAGACGAAGG
GCATCTGCACAGTCAACAAATGATGATCAAAGAATTGGGATGGTTGTCGGAAGACCTAACCCAAGGAATT
GCCTCCCGATCACCTAAAGAACTGGCTGAAGAACTGATTCTCACATTAAATCATTGGTTATTTGTTAAAA
CCGGCTTACGGGGATGGTTGGATAATCCGGCGCAACACAATAGTTGGGAACTATGGATATACCACTATGC
GCGTGCCTATATCGAATCAGTGATTTATGTCTCCATTACCTTTGTCATCCGACTTATTGTGATTGTCTTT
AGCAGCCCGCTTTTTTTACTTGCCGCCTTTGCCGGCCTAACAGAAGGTATGATGATGCGTGATTTACGTA
AATTCGGAGCGGGAAGAGAATCCAGTTTTGTTTATCACCACGCCAGACGTTTGATTGGCCCGGTTATGAT
CGGCGCTTGGATTTTCTATCTCTCGATTCCGGTCTCGATTTACCCTAATCTCGTTTTGATGCCGGCGGCT
TTTTTATTCGGGCTATCCATTTGCGTCACCTTTGCCAGTTTCAAAAAATATCTCTGA
 Primer design