SecReT4
Protein ID: 33152082
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0942
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]750151..750477 [-]
Producthypothetical protein
Component typeTfc7
UniProt IDQ7VMN2
KEGG IDhdu:HD0942
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 108 a.a.     [Download]
>gi|33152082|ref|NP_873435.1| hypothetical protein HD0942 [Haemophilus ducreyi 35000HP]
MDNYNLLDLPDMQIDFNQPVSLSCGLKNQDELMDYFVPYLNDWSEHQYSIHEFAQKYVDKFSLWSANDIV
PIMEVAKTEELACFRIYINHPSGEVVFHCRIKTKGLVQ
 
Nucleotide Sequence: 327 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c750477-750151 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGGATAACTACAATTTATTGGATTTACCCGATATGCAAATTGATTTTAATCAACCGGTATCATTGTCCT
GTGGGCTAAAGAATCAAGATGAATTAATGGATTATTTTGTCCCTTATTTAAATGATTGGAGTGAACATCA
GTACAGTATCCATGAGTTTGCACAAAAATACGTCGATAAATTTTCACTCTGGAGCGCCAATGATATTGTG
CCCATCATGGAGGTTGCTAAAACGGAGGAATTAGCCTGTTTTCGTATCTACATCAATCACCCTTCCGGTG
AAGTCGTTTTTCACTGCCGAATCAAAACAAAAGGATTAGTACAGTAA
 Primer design