SecReT4
Protein ID: 33152083
T4SS name [ID]Tfc [677]
Gene symbol-
Locus tagHD0943
StrainHaemophilus ducreyi 35000HP
Repliconchromosome [GenBank: NC_002940] [Browse all T4SS(s) in this replicon]
Location [Strand]750478..750717 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDQ7VMN1
KEGG IDhdu:HD0943
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 79 a.a.     [Download]
>gi|33152083|ref|NP_873436.1| hypothetical protein HD0943 [Haemophilus ducreyi 35000HP]
MRQNYHAAPNWWESSFSEYTPSRDIAEAFQLMASNKATAVVNDELQYGDIDMPGEEEDDELNVTDDIDDE
NDNDDGEDL
 
Nucleotide Sequence: 240 bp     [Download]
>gi|33151282|ref|NC_002940.2|:c750717-750478 Haemophilus ducreyi 35000HP chromosome, complete genome
ATGCGTCAAAATTATCATGCAGCGCCTAACTGGTGGGAAAGTTCATTTTCCGAATACACCCCGTCACGCG
ATATTGCCGAAGCATTTCAGTTGATGGCATCCAATAAAGCGACCGCTGTTGTCAATGATGAATTACAATA
TGGCGATATTGATATGCCAGGCGAAGAAGAGGATGATGAACTCAATGTCACCGATGATATAGACGATGAA
AATGATAATGATGATGGAGAAGATTTATAA
 Primer design