SecReT4
Protein ID: 332283559
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0306
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]367223..368422 [-]
Producttype IV secretion system protein VirB10
Component typeTrwE
UniProt IDF4GWH3
KEGG IDput:PT7_0306
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-49, Aligned region: 200..377
Protein Sequence: 399 a.a.     [Download]
>gi|332283559|ref|YP_004415470.1| type IV secretion system protein VirB10 [Pusillimonas sp. T7-7]
MKWFKKRSGEVDAVAQIEASQEQFEGKDGRPKFDDAAKPMAPGAKGFLMVLVLAGLVLLVLFVFRMSRSS
DATSDRVSGLTPRIENVLPTLNLRPPRMEPAAQVESPPEPDPEPTPDPSRSLLSQLTLPGEKPLSSGDPI
EQRRLKPGLRAEDSGQSSSGSITRSADSDAQADSGPMSDRLRPMRLSAAKAGFMGNRDLLLTQGAMIDCV
QQTKFVTAQAGMITCYATREVRSASGRVVLIDAGTIFTGYQQSVLAHGQPRVGVVWSRLETPAGVIVNLD
SPATGPLGEAGLDGQIDTHFAARFGAAIMISLISDAGNYLSNRGQGDSGQGFRFDDSQDAAKDAITSVLD
HTMNIPPTLYRNQGGRIGIYVARDLDFSSVYELRTRNADTLPIQTFRIR
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c368422-367223 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAAATGGTTCAAGAAGCGATCCGGCGAAGTGGATGCGGTTGCGCAGATAGAAGCGAGCCAGGAACAGT
TCGAGGGCAAAGATGGCCGCCCCAAGTTTGACGATGCGGCCAAGCCGATGGCGCCCGGAGCCAAAGGATT
CCTCATGGTGTTGGTACTCGCGGGCTTGGTACTGTTGGTTCTGTTTGTCTTTAGAATGAGCCGTAGTAGT
GATGCTACGTCAGATCGCGTTTCAGGCCTCACGCCCCGAATCGAAAACGTGCTGCCGACGCTCAATCTTC
GTCCACCACGGATGGAGCCAGCTGCTCAAGTTGAGTCACCCCCTGAGCCCGATCCAGAACCAACGCCCGA
TCCATCTCGTTCACTGCTCTCACAGCTGACTTTGCCAGGCGAGAAACCTCTATCCAGCGGCGATCCAATT
GAACAGCGCCGCCTTAAGCCTGGGCTCCGTGCCGAAGATTCGGGTCAATCCAGCTCAGGCTCGATTACTC
GTTCAGCGGATTCAGATGCACAAGCCGATAGTGGCCCTATGTCTGACCGGTTGCGTCCGATGCGATTGAG
TGCCGCTAAAGCGGGATTCATGGGTAATCGGGATCTTTTGCTAACCCAAGGAGCCATGATCGACTGCGTA
CAACAAACGAAGTTCGTCACAGCACAAGCGGGGATGATCACGTGCTATGCCACTCGCGAAGTGCGTTCGG
CAAGCGGCCGTGTTGTGCTTATCGACGCCGGCACGATCTTTACCGGATACCAGCAATCCGTACTGGCACA
TGGACAGCCTCGGGTAGGTGTTGTTTGGTCTAGACTCGAAACACCGGCCGGCGTCATTGTGAATCTGGAT
TCTCCTGCGACGGGCCCTTTGGGCGAAGCCGGTTTAGACGGACAAATCGATACCCACTTTGCGGCCCGAT
TTGGTGCGGCCATCATGATCAGCTTGATTAGCGATGCCGGCAACTACCTGAGTAATCGCGGCCAAGGCGA
CAGTGGACAGGGTTTTCGATTTGACGATTCCCAGGACGCGGCTAAAGATGCCATTACGTCGGTTCTGGAT
CACACGATGAATATCCCGCCCACGCTTTACCGAAACCAGGGAGGCCGGATTGGCATCTACGTTGCAAGAG
ATCTGGACTTCAGCAGCGTCTACGAGCTACGCACCCGTAACGCCGACACCTTACCTATTCAAACCTTCCG
TATCAGGTAG
 Primer design