SecReT4
Protein ID: 332283560
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0307
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]368419..369231 [-]
Producttype IV secretion system protein VirB9
Component typeTrwF
UniProt IDF4GWH4
KEGG IDput:PT7_0307
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.9e-55, Aligned region: 34..243
Protein Sequence: 270 a.a.     [Download]
>gi|332283560|ref|YP_004415471.1| type IV secretion system protein VirB9 [Pusillimonas sp. T7-7]
MSRMAWTKLLLAGLLASTAVHSWALDIPKASPKDKRIRITQYDRNDVIKISTMTGVATHIELSDDETFIT
HAFGDKEAYDFNQFEKHLLLKPTAPQANTNLIVITNKRRYAFLLEHVAEGSGKEVHSLTLDYPELEQLRL
SAQKRFEDIDQALANTGLAVNWTGYTMSGDETLAPVSAWDDGAQTWLRFAPGQDLPAVYFVDADGQEVIA
NRHMYDAHTIVMHRVAAKWHLRLGDQVLAIYNEHSNQTRSLPTRTISPEIERVLRKEPDQ
 
Nucleotide Sequence: 813 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c369231-368419 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAGCAGGATGGCTTGGACTAAGTTATTGCTGGCCGGACTCCTAGCCAGCACGGCAGTTCATTCGTGGG
CATTGGATATTCCAAAAGCCTCACCCAAGGATAAGCGGATTCGCATCACGCAATACGATCGAAACGATGT
CATCAAGATTTCCACCATGACAGGAGTAGCTACCCATATAGAACTGTCAGATGACGAAACGTTTATTACC
CATGCTTTTGGCGACAAGGAGGCGTACGACTTCAACCAGTTCGAAAAGCATCTTTTATTGAAGCCCACAG
CTCCCCAGGCCAATACGAACCTGATCGTTATCACGAACAAGCGTCGCTACGCTTTCCTTCTGGAACACGT
GGCTGAAGGAAGCGGCAAAGAAGTTCATAGCCTTACTCTGGACTATCCAGAGCTAGAGCAACTGCGTCTG
TCGGCCCAGAAACGATTCGAGGACATTGATCAGGCGTTGGCCAATACCGGACTAGCCGTCAACTGGACGG
GATACACCATGAGTGGCGATGAGACCTTAGCCCCCGTCAGTGCATGGGATGACGGCGCCCAGACCTGGTT
GCGTTTCGCACCTGGCCAAGACCTGCCTGCGGTCTACTTCGTCGATGCGGATGGTCAAGAAGTCATTGCC
AATCGCCACATGTACGATGCCCACACCATCGTCATGCATCGCGTTGCTGCAAAGTGGCATCTGCGCCTGG
GTGACCAGGTACTGGCTATCTACAACGAACACAGCAATCAAACCCGCAGCTTGCCGACACGCACGATCTC
TCCCGAGATTGAGCGGGTGCTGCGCAAGGAGCCCGATCAATGA
 Primer design