SecReT4
Protein ID: 332283563
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0310
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]370068..370754 [-]
Producttype IV secretion system protein VirB8
Component typeTrwG
UniProt IDF4GWH7
KEGG IDput:PT7_0310
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3e-54, Aligned region: 16..222
Protein Sequence: 228 a.a.     [Download]
>gi|332283563|ref|YP_004415474.1| type IV secretion system protein VirB8 [Pusillimonas sp. T7-7]
MSSDDPKLSLEDEMERAQGLERDLITEILQSRRRAWTVALSAGVLTIASVVAVASLMPMKEPPELYIVRV
DNASGMIEHVSQLGNAQDDYGERLARFFINQYVLACESYDWYTIQQSYNRCALFSSPDVQRAYYERFKGE
KALDKVYGQHSRVRVDVRSITLGPNQSATVRFSRSIENSMGKASPVENLLATLGYGYINANLSEAVGREN
PLGFQVLSYDTDVEVVGR
 
Nucleotide Sequence: 687 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c370754-370068 Pusillimonas sp. T7-7 chromosome, complete genome
ATGTCTTCCGACGATCCCAAGCTCTCGCTTGAAGATGAAATGGAACGTGCCCAAGGCCTGGAGCGCGACT
TAATTACTGAAATACTTCAATCTCGGCGGCGAGCATGGACCGTCGCCCTATCCGCTGGTGTCCTGACGAT
AGCTTCTGTCGTAGCCGTAGCGTCGTTAATGCCAATGAAGGAACCTCCCGAGCTTTATATCGTTCGTGTG
GACAATGCTTCCGGAATGATCGAGCACGTCTCACAGTTGGGCAATGCTCAAGACGACTACGGCGAACGGC
TGGCACGGTTCTTCATCAACCAGTATGTCCTGGCGTGCGAAAGCTACGACTGGTACACGATCCAACAGTC
TTACAACCGTTGCGCTCTGTTCAGCAGTCCCGATGTTCAACGGGCTTACTACGAGCGCTTTAAAGGCGAA
AAGGCTTTGGACAAGGTCTATGGTCAGCATTCCCGCGTTCGAGTGGATGTTAGATCGATCACGTTGGGGC
CGAATCAAAGCGCCACCGTGCGCTTTAGTCGCTCGATCGAGAACAGCATGGGTAAAGCAAGCCCGGTCGA
GAACCTGCTTGCCACATTAGGTTACGGCTATATCAATGCCAACTTGTCTGAGGCAGTCGGCCGGGAGAAC
CCGCTGGGCTTTCAAGTCCTGAGCTACGACACCGACGTTGAGGTCGTAGGCCGATGA
 Primer design