SecReT4
Protein ID: 332283570
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0317
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]374182..374895 [-]
ProductTraF protein
Component typeTrwJ
UniProt IDF4GWI4
KEGG IDput:PT7_0317
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3e-42, Aligned region: 26..217
Protein Sequence: 237 a.a.     [Download]
>gi|332283570|ref|YP_004415481.1| TraF protein [Pusillimonas sp. T7-7]
MKPTLKWLQSLAAAALVCLSIPAHGQIPVTDGASITARAAQHAESLAKYLEQIATLKAQLESAHRQYEAI
TGARNLGDILNNPTIRNSIPADVRVVLRRGESSIGSIQHSVNRIRDEERLTGNYAVDSQALSRRVEDLGL
RSQALLEQAQEGIGDRMLQLDQLQQQINLATDPKAISDLQARLQVEQANIQADQIRADLLSRQLEAEKVL
IEQQSAQLVRQSSLSVDAIRAPIPDIR
 
Nucleotide Sequence: 714 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c374895-374182 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAAACCCACTCTCAAGTGGCTGCAAAGCCTTGCAGCCGCCGCTTTGGTGTGTCTGTCAATACCGGCGC
ATGGACAGATCCCAGTCACCGACGGCGCAAGTATCACTGCCAGGGCAGCGCAACACGCCGAATCTCTGGC
GAAGTATCTTGAACAGATCGCAACGCTCAAGGCGCAGTTGGAATCCGCCCACCGCCAGTACGAGGCCATC
ACCGGCGCACGTAATCTTGGCGACATTCTGAACAATCCCACCATCCGCAACTCAATACCGGCGGATGTGC
GTGTCGTGCTCAGGCGTGGGGAAAGCTCTATTGGTTCTATTCAGCATTCGGTCAATCGCATTCGTGACGA
AGAGCGGCTCACCGGAAACTACGCCGTTGATAGCCAGGCTCTGTCTCGGCGAGTCGAAGATCTAGGGTTG
CGCAGCCAAGCGCTTCTTGAGCAGGCGCAAGAAGGTATTGGCGATCGGATGCTGCAACTAGACCAGCTGC
AGCAACAAATCAATTTAGCGACCGATCCCAAAGCGATATCTGACCTGCAAGCAAGGCTGCAGGTTGAACA
AGCCAACATCCAAGCAGATCAGATTCGAGCTGACCTACTCTCACGCCAGCTCGAGGCCGAGAAAGTCCTC
ATCGAGCAACAGTCAGCGCAGTTGGTCCGACAGAGCTCGTTAAGTGTCGACGCCATTCGAGCCCCGATAC
CAGACATTCGATAA
 Primer design