SecReT4
Protein ID: 332283573
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0320
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]377715..378026 [-]
Producthypothetical protein
Component typeTrwL
UniProt IDF4GWI7
KEGG IDput:PT7_0320
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.3e-08, Aligned region: 9..95
Protein Sequence: 103 a.a.     [Download]
>gi|332283573|ref|YP_004415484.1| hypothetical protein PT7_0320 [Pusillimonas sp. T7-7]
MPIKSNRHYWFLFIALAVACALLLIPGISLAQVGGGLEKGTDAAEQFREWLWLIIPIACTIAGLILAFMY
SADLIRKDTLWQWGGGVFFGGILVGAIIKLFFS
 
Nucleotide Sequence: 312 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c378026-377715 Pusillimonas sp. T7-7 chromosome, complete genome
ATGCCCATCAAATCAAACCGCCACTATTGGTTCCTATTCATCGCATTGGCTGTCGCCTGCGCACTATTAC
TGATCCCGGGAATAAGTCTGGCACAGGTCGGCGGTGGTCTGGAAAAAGGGACTGATGCCGCAGAACAATT
CAGAGAGTGGCTCTGGCTCATCATTCCGATCGCCTGCACGATCGCAGGTCTGATATTGGCCTTCATGTAT
TCGGCCGACTTAATCCGCAAAGATACGCTCTGGCAATGGGGCGGAGGTGTGTTCTTTGGAGGAATTCTGG
TCGGAGCGATCATTAAGCTGTTCTTCTCATGA
 Primer design