SecReT4
Protein ID: 332283574
T4SS name [ID]Trw [137]
Gene symbol-
Locus tagPT7_0321
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]378166..378852 [-]
Producttype IV secretion system protein VirB1
Component typeTrwN
UniProt IDF4GWI8
KEGG IDput:PT7_0321
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.7e-21, Aligned region: 6..144
Protein Sequence: 228 a.a.     [Download]
>gi|332283574|ref|YP_004415485.1| type IV secretion system protein VirB1 [Pusillimonas sp. T7-7]
MIEFIELAKACAPDVHATTMMAIVRHESGFDPLAIGVNEKPHRSIKSKTRKEAIQAVQALLDSGKNFDAG
YGQINSANWKWLGITPENVFDPCTNLGAAQRVLVNCYEGASKKLNGPDALLAALSCYNTGNYRNGLINGY
VDKVLAGAKSTEHVKVPALSTGSKDHAHQLGAKSPQSKLQDAVPSKMNPDALGRNSKPDAFHAPRPDAFS
QPFQAFSPVGSIIYHGRR
 
Nucleotide Sequence: 687 bp     [Download]
>gi|332283253|ref|NC_015458.1|:c378852-378166 Pusillimonas sp. T7-7 chromosome, complete genome
ATGATCGAATTTATAGAATTGGCCAAGGCTTGCGCACCCGACGTACATGCCACCACAATGATGGCCATCG
TGCGCCATGAATCGGGCTTCGATCCCTTGGCGATTGGCGTCAATGAAAAGCCACATCGAAGCATCAAATC
GAAAACACGTAAAGAGGCCATCCAGGCGGTACAAGCCCTGCTCGACTCAGGCAAGAACTTCGATGCTGGT
TATGGCCAGATCAATAGCGCGAATTGGAAATGGCTTGGCATTACGCCAGAGAACGTTTTCGACCCTTGCA
CGAACCTGGGCGCAGCGCAACGTGTGTTGGTCAATTGCTACGAAGGCGCCAGCAAAAAACTGAACGGTCC
TGATGCATTGTTAGCGGCACTCAGTTGTTACAACACCGGCAACTATCGAAACGGACTCATCAACGGCTAC
GTCGACAAGGTCCTGGCCGGCGCCAAATCAACGGAACACGTCAAAGTGCCCGCATTGTCTACCGGCAGCA
AAGATCACGCCCATCAGCTAGGTGCAAAGTCACCACAGTCCAAGTTGCAGGATGCGGTGCCATCCAAAAT
GAACCCAGACGCGCTCGGCCGTAACTCGAAACCGGATGCGTTCCATGCGCCACGCCCGGACGCGTTTTCC
CAACCTTTTCAAGCTTTTTCGCCCGTCGGATCAATCATCTATCACGGTCGCCGTTAA
 Primer design