SecReT4
Protein ID: 332285022
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1769
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1891875..1892537 [+]
Producttype IV secretion system protein VirB1
Component typeTrwN
UniProt IDF4GML5
KEGG IDput:PT7_1769
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.9e-21, Aligned region: 8..149
Protein Sequence: 220 a.a.     [Download]
>gi|332285022|ref|YP_004416933.1| type IV secretion system protein VirB1 [Pusillimonas sp. T7-7]
MIAELAALALTCAPNIHPVTLHALIRHESRVKQYAIGVNRKVQHLRQQPKTLAEATAAADRLIDQGIDFD
AGLGQINVRNWAWLNLDSKSVFDPCRNLAAAQTVLAECYARALPRQTDPQHALRAALSCYNTGNFKRGFT
NGYVGKVLAQAKIKVPALAPLKNETTEPATKATPAESAQKPDQVPAQPEGTPDGFSANPATDGFSQTRDG
EPESSPNSDT
 
Nucleotide Sequence: 663 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1891875-1892537 Pusillimonas sp. T7-7 chromosome, complete genome
ATGATCGCAGAACTTGCAGCCTTGGCCCTCACCTGCGCACCCAACATCCACCCAGTCACCCTGCATGCAC
TGATTCGTCACGAATCCCGAGTCAAGCAGTACGCCATCGGCGTCAACCGCAAGGTCCAGCACCTGCGACA
GCAACCCAAAACATTGGCCGAAGCGACCGCAGCCGCTGATCGCCTCATTGACCAAGGCATCGACTTCGAT
GCCGGGCTGGGACAGATCAATGTTCGCAACTGGGCGTGGTTGAACCTCGATAGCAAGTCCGTCTTTGATC
CCTGCCGCAATCTGGCGGCTGCCCAGACGGTACTGGCAGAGTGCTATGCCAGAGCGTTACCCCGACAGAC
GGACCCGCAGCATGCCTTGCGCGCGGCGCTGTCCTGCTACAACACCGGCAATTTCAAGCGCGGTTTCACC
AATGGCTATGTAGGCAAAGTGCTGGCCCAAGCCAAGATCAAGGTTCCTGCCTTGGCACCGTTGAAAAACG
AAACGACCGAGCCCGCGACAAAGGCTACGCCGGCAGAATCGGCGCAAAAACCCGATCAAGTACCGGCTCA
ACCCGAAGGCACACCGGACGGCTTCAGCGCCAACCCGGCAACCGACGGCTTTTCACAAACGCGTGACGGC
GAGCCAGAAAGCAGCCCTAATTCCGACACCTGA
 Primer design