SecReT4
Protein ID: 332285023
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1770
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1892628..1892948 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDF4GML6
KEGG IDput:PT7_1770
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-08, Aligned region: 14..101
Protein Sequence: 106 a.a.     [Download]
>gi|332285023|ref|YP_004416934.1| conjugal transfer protein TrwL [Pusillimonas sp. T7-7]
MSLLKHFKNAMSYLRIINKPTTAALLLGIHQVAFAQSIGGLSRAQTTLQTLRDNLDVILPIAAIIIGVII
FVLYSAEVMRKDDAIRWGIGVLLAGSVAELVVLLWR
 
Nucleotide Sequence: 321 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1892628-1892948 Pusillimonas sp. T7-7 chromosome, complete genome
ATGTCTCTACTGAAACACTTCAAGAACGCTATGTCCTACCTGCGCATCATCAACAAACCGACTACAGCCG
CACTGCTGCTTGGCATCCATCAAGTTGCATTTGCACAATCCATTGGCGGCCTTTCCCGAGCGCAAACAAC
ATTACAGACCCTCCGGGACAATCTGGATGTCATCCTGCCCATTGCGGCCATCATCATCGGCGTCATCATT
TTTGTACTGTATTCCGCAGAGGTCATGCGCAAAGACGATGCCATCCGTTGGGGCATCGGCGTGCTGCTGG
CCGGATCAGTGGCCGAACTGGTTGTGTTGCTTTGGAGGTAA
 Primer design