SecReT4
Protein ID: 332285027
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1774
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1896930..1897634 [+]
Producttype IV secretion system protein VirB5
Component typeTrwJ
UniProt IDF4GMM0
KEGG IDput:PT7_1774
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.5e-38, Aligned region: 25..214
OmpH [PF03938], Evalue: 1.1e-06, Aligned region: 11..210
Protein Sequence: 234 a.a.     [Download]
>gi|332285027|ref|YP_004416938.1| type IV secretion system protein VirB5 [Pusillimonas sp. T7-7]
MTRCKSFAAGIILSAAFLNSAHASGIPTVDAATIAQLQEQLLTARDQLKNLTDQLATAKSQLAAFTQSSG
YGNVVGNADIRNQLRAALPSNAQSLLDRSGGSSLDGDVGRITDEVMAPVNFQKDRQSLSRRSLNIEATSK
AMSERAYDSMTRRLANVDALQNKINQTTNPKEIAELQARIQIEQANIQAEQTRIQLASQQLDAERNLLQA
RAQQVYRGWFGSTTNASDATNPAK
 
Nucleotide Sequence: 705 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1896930-1897634 Pusillimonas sp. T7-7 chromosome, complete genome
ATGACACGCTGCAAGTCGTTTGCGGCGGGCATAATCCTGTCCGCTGCCTTTCTAAATTCTGCCCATGCCA
GCGGCATCCCCACCGTCGATGCGGCAACGATCGCCCAATTGCAGGAGCAACTGCTGACCGCCCGGGACCA
ATTGAAGAATCTAACCGATCAGCTAGCTACAGCCAAAAGTCAGCTGGCTGCTTTCACACAGTCCAGCGGC
TACGGTAACGTTGTCGGCAACGCCGATATTCGGAACCAACTGCGCGCTGCCCTGCCATCCAATGCTCAGA
GCCTACTGGACCGCTCGGGAGGGTCGAGCCTGGATGGCGATGTAGGCCGCATCACAGACGAGGTGATGGC
TCCCGTGAATTTTCAGAAGGATCGCCAGAGCCTGTCCAGGCGCTCTCTGAATATTGAGGCCACATCCAAG
GCCATGAGCGAACGGGCCTATGATTCCATGACTCGACGCCTAGCCAACGTAGATGCTTTACAGAACAAGA
TCAATCAGACAACAAACCCAAAGGAAATCGCGGAACTACAGGCTCGCATTCAGATAGAGCAGGCCAACAT
TCAAGCGGAGCAGACACGGATTCAGCTAGCATCCCAACAACTGGATGCCGAGCGCAATCTATTGCAGGCG
CGAGCACAGCAAGTGTATAGGGGTTGGTTTGGTAGCACCACTAATGCCAGCGATGCCACCAATCCTGCAA
AGTGA
 Primer design