SecReT4
Protein ID: 332285029
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1776
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1898686..1898823 [+]
Producthypothetical protein
Component typeTrwH
UniProt IDF4GMM2
KEGG IDput:PT7_1776
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 45 a.a.     [Download]
>gi|332285029|ref|YP_004416940.1| hypothetical protein PT7_1776 [Pusillimonas sp. T7-7]
MKNLFAALALAGLLTGCAFHAPQPPKPADTSRVPVNATPPLFKGV
 
Nucleotide Sequence: 138 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1898686-1898823 Pusillimonas sp. T7-7 chromosome, complete genome
ATGAAAAACCTCTTTGCCGCCCTCGCGCTGGCCGGGCTGCTGACTGGTTGCGCCTTTCATGCGCCCCAGC
CGCCGAAACCGGCCGATACGTCACGCGTGCCGGTCAATGCCACGCCGCCTCTTTTCAAAGGAGTTTGA
 Primer design