SecReT4
Protein ID: 332285030
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1777
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1898827..1899513 [+]
Producttype IV secretion system protein VirB8
Component typeTrwG
UniProt IDF4GMM3
KEGG IDput:PT7_1777
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-51, Aligned region: 17..222
Protein Sequence: 228 a.a.     [Download]
>gi|332285030|ref|YP_004416941.1| type IV secretion system protein VirB8 [Pusillimonas sp. T7-7]
MSASLKSEDVAAYLEQSRGLERDHLGELVSSRKRAWQVALGAGLIALASIAAVAGLTPLKQPPEMYVVRV
DSATGSIEHVSTLGQPLEDYGQRIAKYFLNTYVLNCEGYSWQTIQEQFDTCALLSSAPIQTQYGKRFEGQ
DAVTTRLGTQGTVDVQVHSITLGANQAAIVRFTKTEREITTGNITKAQHLIATMAYQYTDVPLTEEVARL
NPLGFQVMRYDLAADLSR
 
Nucleotide Sequence: 687 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1898827-1899513 Pusillimonas sp. T7-7 chromosome, complete genome
GTGTCCGCATCACTTAAATCCGAAGACGTTGCCGCTTACCTGGAGCAGTCGCGCGGCCTGGAGCGCGATC
ACCTCGGCGAGCTCGTCAGCAGCCGTAAACGGGCCTGGCAGGTGGCCCTCGGTGCAGGCCTGATCGCCCT
GGCCTCCATCGCTGCTGTTGCTGGCCTCACCCCTTTGAAGCAGCCGCCTGAAATGTATGTGGTCCGCGTC
GATAGCGCCACCGGCTCCATCGAACATGTCAGCACCCTGGGCCAGCCGCTCGAAGACTACGGTCAGCGCA
TCGCCAAGTATTTTTTGAATACGTACGTGCTGAACTGCGAGGGCTATAGCTGGCAGACGATACAGGAGCA
ATTCGACACGTGCGCCCTGCTGTCTTCTGCACCCATCCAGACGCAGTACGGAAAACGATTCGAAGGGCAG
GACGCCGTCACGACACGCCTCGGTACTCAGGGCACAGTCGATGTGCAGGTTCATTCGATCACATTGGGTG
CCAACCAGGCCGCCATCGTGCGCTTTACCAAGACAGAGCGGGAAATCACCACGGGCAACATTACCAAGGC
TCAGCACCTGATTGCCACCATGGCTTACCAATACACCGACGTGCCGCTCACCGAAGAGGTCGCCCGCCTG
AACCCGCTGGGCTTTCAGGTCATGCGCTATGACTTGGCTGCCGACTTGTCGCGCTGA
 Primer design