SecReT4
Protein ID: 332285031
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1778
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1899541..1900428 [+]
Producttype IV secretion system protein VirB9
Component typeTrwF
UniProt IDF4GMM4
KEGG IDput:PT7_1778
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-59, Aligned region: 35..244
Protein Sequence: 295 a.a.     [Download]
>gi|332285031|ref|YP_004416942.1| type IV secretion system protein VirB9 [Pusillimonas sp. T7-7]
MFKHFPSRQALALLLCLAIPASALALETPRSSRLDHRVRYVNYNDANVIQLNAVIGVATHIVLEPGEKYV
YHVFGDSQAYAFTYKNNHLFFKPTAEEANTNLIVVTDRRDYSFRLSYSDNRNSAALYKLVVRYPEVQARQ
RTQAAQKAAIERSLQAVSSNMNWQAYTRSGDAAIAPVHAWDDGRQTWLQFAPQADIPAVYRVTPDGQEVI
TNHHMADERTMVLHRTSALWHLRLGDQVLAIHNDAYGITPVPAHTGTASPAVRRSIKGSASPQSPTAAPV
PTIRIREATQERNSP
 
Nucleotide Sequence: 888 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1899541-1900428 Pusillimonas sp. T7-7 chromosome, complete genome
ATGTTTAAACATTTCCCCAGTCGGCAGGCGCTGGCGTTGCTTCTTTGCCTGGCCATCCCTGCTAGCGCGC
TGGCGCTGGAGACCCCTCGTTCCTCGCGGCTCGACCACCGCGTGCGCTATGTCAATTACAACGACGCCAA
TGTCATCCAGCTCAACGCCGTGATCGGCGTGGCCACCCATATCGTGCTGGAGCCCGGCGAAAAATACGTC
TACCACGTCTTTGGCGATAGCCAAGCCTATGCGTTTACCTACAAGAACAATCATCTGTTCTTCAAACCCA
CGGCAGAAGAAGCCAACACCAACCTTATCGTCGTCACTGACAGGCGCGATTACAGCTTCAGGCTCTCGTA
CAGCGACAACCGCAATTCAGCCGCCTTGTACAAACTCGTGGTTCGTTATCCAGAGGTTCAAGCCAGGCAA
CGAACCCAGGCCGCACAAAAGGCTGCGATTGAGCGATCCTTACAAGCCGTCAGCTCGAACATGAACTGGC
AGGCCTACACCCGCAGCGGCGACGCGGCCATCGCGCCGGTACACGCCTGGGATGACGGTCGTCAGACCTG
GCTGCAGTTTGCACCGCAAGCCGACATTCCGGCCGTGTACCGCGTCACGCCTGACGGCCAGGAAGTCATC
ACCAATCACCACATGGCAGATGAACGCACCATGGTGCTGCATCGCACGTCTGCCTTATGGCACCTTCGCC
TGGGCGACCAAGTGCTGGCGATTCACAACGACGCCTACGGCATCACACCCGTACCAGCACATACCGGGAC
GGCATCACCCGCAGTCAGACGCAGCATCAAGGGTAGTGCGAGCCCGCAGTCGCCCACTGCGGCACCTGTG
CCCACCATCCGCATACGCGAAGCCACGCAAGAAAGGAATTCCCCATGA
 Primer design