SecReT4
Protein ID: 332285032
T4SS name [ID]Trw [138]
Gene symbol-
Locus tagPT7_1779
StrainPusillimonas sp. T7-7
Repliconchromosome [GenBank: NC_015458] [Browse all T4SS(s) in this replicon]
Location [Strand]1900425..1901552 [+]
Producttype IV secretion system protein VirB10
Component typeTrwE
UniProt IDF4GMM5
KEGG IDput:PT7_1779
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.5e-57, Aligned region: 189..365
Protein Sequence: 375 a.a.     [Download]
>gi|332285032|ref|YP_004416943.1| type IV secretion system protein VirB10 [Pusillimonas sp. T7-7]
MTEKEQDQAQASQEGNPKDANLERETLNLEATGRSAPRGARAFLWLTILIAVAVAAGVLMKVWSREPAAK
ADSGLEADQSGITNRLKAPKVERPTPPPTLPPPSSEPTVVSSYNVPPPMPAAPPPVDELTQRRLASPLQA
GGTDASAATPSQSNGPQGPYSDAGPLADKLRPLELAPSVAGQLGDRNFLLTQGTMIDCTLQTKLVSAQSG
LLTCLATHDVMSANGKVKLIDAGTKFTGYQSGGIQQGQARAFVTWNRLETPTGVIVNLSSPGTGPLGEAG
LGGHIDNHFWERFGNAILLSLVGDFGNWASNQGQSGSNNIRFDNTAEGGQEAVAKILEKSLDIPPTLYKN
QGERIGIMVARDLDFSHVYELEPIH
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|332283253|ref|NC_015458.1|:1900425-1901552 Pusillimonas sp. T7-7 chromosome, complete genome
ATGACGGAAAAGGAACAAGATCAGGCACAAGCCTCGCAAGAGGGGAACCCTAAAGACGCTAATCTGGAGC
GGGAAACACTGAATCTGGAAGCAACCGGGCGCAGCGCCCCACGCGGTGCCCGCGCTTTTCTGTGGCTCAC
CATCCTGATCGCTGTGGCAGTGGCTGCCGGTGTGCTCATGAAGGTCTGGAGCCGCGAACCAGCGGCAAAA
GCCGATAGCGGTCTGGAAGCCGATCAAAGCGGCATTACCAATCGCCTCAAAGCCCCCAAGGTCGAGCGCC
CCACGCCACCTCCAACACTGCCGCCTCCGTCATCCGAGCCAACGGTGGTGTCCAGCTACAACGTCCCACC
ACCCATGCCCGCAGCTCCGCCTCCTGTCGATGAACTTACCCAGCGTCGGCTGGCCAGCCCGCTACAGGCG
GGTGGCACAGACGCAAGCGCCGCGACCCCAAGCCAGTCAAATGGCCCTCAAGGCCCTTATAGCGATGCTG
GCCCTCTGGCCGACAAGCTGCGACCGCTGGAGCTGGCCCCATCAGTGGCCGGGCAACTGGGTGACCGCAA
CTTCCTGCTCACGCAAGGCACCATGATCGACTGCACCCTGCAGACAAAACTGGTCAGCGCCCAGTCCGGG
CTTCTGACGTGTCTGGCCACACACGATGTCATGAGCGCCAACGGCAAGGTCAAGCTCATTGATGCCGGCA
CCAAATTCACGGGCTACCAGTCTGGAGGCATACAGCAAGGCCAGGCCCGCGCCTTTGTGACCTGGAACCG
ACTGGAAACGCCTACCGGCGTCATCGTGAACCTGAGTTCCCCCGGCACAGGCCCGCTGGGCGAAGCGGGA
TTGGGCGGGCATATCGACAACCACTTCTGGGAACGCTTTGGCAACGCCATTCTACTTTCTCTGGTGGGCG
ACTTCGGTAACTGGGCATCCAATCAAGGGCAATCGGGCAGCAACAACATCCGCTTTGACAACACCGCCGA
AGGCGGACAGGAAGCGGTCGCAAAGATTTTGGAGAAGTCCCTGGACATTCCTCCCACCCTTTACAAGAAC
CAGGGCGAGCGTATCGGCATCATGGTCGCCCGTGATCTGGATTTCAGTCACGTCTATGAGCTTGAACCCA
TCCACTGA
 Primer design