SecReT4
Protein ID: 332288406
T4SS name [ID]Tfc [680]
Gene symbol-
Locus tagUMN179_00324
StrainGallibacterium anatis UMN179
Repliconchromosome [GenBank: NC_015460] [Browse all T4SS(s) in this replicon]
Location [Strand]333516..335483 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDF4HBK4
KEGG IDgan:UMN179_00324
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 655 a.a.     [Download]
>gi|332288406|ref|YP_004419258.1| integrating conjugative element protein [Gallibacterium anatis UMN179]
MITNKFKLSFLALLLMSGSYSYADFFSTNTNKDLSINQSGSVLSDNVFYQIGGGSAVMTPPSRKRPHELA
LGLGWKANLMCGNFDIQTTVKNQLNGITDGFKDLMGNVIQSATGAVASMPAMIIQRANPQLYDILTNGVL
QGRLDFADAKTSCEELANKAADYMADAGWGMMAKQQNFQEIASTEQDAVRAKQKSDKEDGKRGINWVGGE
KRGGEGQKLIDVIGDVVAAGHNILNGKPVLSSSAVSNSECSGAMCQTFPKPSDIRDFTKRVIGDKGIKTC
NTCGEQKATAGSGLSPVIEEEHIKVLKDLQDVLNTPEPTTEQLQAVSSPMIPVTRGLIEALKEDPEAKVL
AHRLASEVALSKVLNKALLARRAILAGMREPNVAVNDKAQTELEKALVMLDREIEQVRMEMELQRSLTNN
TALMVINKRVRDQQDTLNSNAGDKQHNFEGKQDDLNNSNEGDFYISPDEPIYLDIPDGSGGTGVYNGINT
GGSGKNSGGAGALSKYESSDAYADGRATVYRTADGKFVRREGGSLAWRNNNPGNIKMGDFAKSMGAIGVG
PGGFAIFPDEATGERAIHALLKTNSYNNLSIAKAMERYAPPKENDTELYIRQITKATGLDRNTSMSSLSD
EQRAQFVKAIRKHEGWITGKEVPTN
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|332288085|ref|NC_015460.1|:333516-335483 Gallibacterium anatis UMN179 chromosome, complete genome
ATGATAACAAACAAATTTAAACTTTCATTTTTAGCTTTATTGTTGATGTCTGGTAGTTACAGCTACGCCG
ATTTTTTCTCTACCAACACCAACAAAGATTTATCCATTAATCAATCCGGATCGGTGTTATCTGATAATGT
GTTTTATCAGATCGGCGGAGGTTCTGCAGTGATGACTCCACCGTCCAGAAAAAGACCTCACGAATTAGCA
CTAGGGCTTGGCTGGAAAGCGAATTTGATGTGCGGTAATTTTGATATACAAACAACGGTTAAAAATCAAC
TTAACGGCATCACTGACGGATTTAAAGACCTAATGGGTAACGTTATTCAATCGGCGACCGGTGCAGTAGC
CAGTATGCCAGCTATGATTATCCAACGCGCCAACCCTCAGCTGTATGACATACTAACAAACGGTGTGTTG
CAAGGACGACTAGATTTTGCAGATGCAAAAACCAGTTGTGAAGAACTTGCCAATAAAGCCGCTGATTATA
TGGCTGATGCCGGCTGGGGAATGATGGCAAAACAACAAAATTTCCAAGAAATCGCTTCAACCGAACAAGA
TGCTGTTAGAGCCAAACAAAAATCTGATAAAGAAGATGGAAAAAGAGGTATTAATTGGGTAGGTGGCGAA
AAACGAGGAGGTGAAGGTCAGAAGCTGATTGATGTTATCGGCGACGTTGTCGCTGCCGGACATAACATTC
TGAACGGAAAACCTGTTTTAAGCTCTTCTGCTGTGTCAAACAGTGAATGTAGTGGTGCTATGTGTCAAAC
TTTTCCGAAACCATCCGATATTCGAGATTTTACCAAACGCGTGATCGGCGATAAGGGTATTAAAACGTGC
AATACCTGCGGTGAACAAAAAGCGACAGCCGGCTCTGGATTATCTCCGGTAATTGAAGAAGAACACATCA
AAGTGTTAAAAGATTTACAAGACGTACTTAATACACCTGAACCCACTACTGAACAATTACAGGCTGTTAG
TTCACCGATGATCCCTGTTACTCGAGGATTAATCGAAGCATTGAAAGAAGATCCGGAAGCAAAAGTACTT
GCTCACCGGCTTGCCAGTGAAGTTGCTCTCTCTAAAGTATTGAATAAAGCCTTATTAGCCAGACGAGCGA
TTTTGGCAGGAATGCGTGAACCGAACGTGGCCGTCAACGATAAGGCTCAAACCGAACTTGAAAAAGCATT
AGTAATGCTTGATCGTGAGATTGAACAAGTCAGGATGGAAATGGAATTACAGCGTTCTCTCACTAACAAT
ACGGCTTTAATGGTCATTAATAAACGAGTTCGTGATCAACAAGATACGCTCAACAGTAATGCCGGCGATA
AACAGCATAACTTTGAAGGTAAACAAGATGATCTTAATAACAGTAACGAAGGGGATTTCTACATCAGCCC
TGATGAGCCTATTTATCTTGATATTCCTGATGGTTCCGGCGGAACAGGTGTTTATAACGGCATCAATACC
GGTGGAAGCGGTAAAAATTCCGGTGGCGCTGGTGCGTTGTCAAAATATGAATCTAGTGATGCATATGCAG
ACGGCAGAGCTACAGTCTATCGTACAGCAGATGGGAAATTTGTTCGTAGAGAAGGAGGTTCTTTAGCTTG
GCGTAATAACAATCCTGGTAATATTAAAATGGGAGATTTTGCAAAAAGTATGGGGGCAATTGGCGTAGGG
CCAGGAGGGTTTGCTATTTTCCCAGATGAAGCAACAGGAGAAAGGGCAATACACGCTCTGTTAAAAACAA
ATTCATATAATAATTTGAGTATTGCTAAAGCAATGGAGCGTTACGCCCCGCCTAAAGAGAACGATACGGA
ATTATATATTCGTCAAATTACAAAAGCGACAGGACTTGACAGAAATACCTCTATGAGTTCATTATCTGAT
GAGCAACGTGCACAATTTGTGAAGGCAATTCGCAAGCACGAGGGCTGGATCACTGGGAAAGAAGTCCCAA
CTAATTAA
 Primer design