SecReT4
Protein ID: 332288422
T4SS name [ID]Tfc [680]
Gene symbol-
Locus tagUMN179_00340
StrainGallibacterium anatis UMN179
Repliconchromosome [GenBank: NC_015460] [Browse all T4SS(s) in this replicon]
Location [Strand]348278..348631 [-]
Productconjugative transfer region protein
Component typeTfc11
UniProt IDF4HBM0
KEGG IDgan:UMN179_00340
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.2e-34, Aligned region: 4..116
Protein Sequence: 117 a.a.     [Download]
>gi|332288422|ref|YP_004419274.1| conjugative transfer region protein [Gallibacterium anatis UMN179]
MEKDETIQFLPERLNRQPVVFRGMTISELLVVFGVGFVVGLLLGIVATVLIGDWALIPTCALGLAFLFTF
KGGNVIARLKRGKPDTWLPRYLEQRFKTNRLLIDKTDNRKYWSIRRG
 
Nucleotide Sequence: 354 bp     [Download]
>gi|332288085|ref|NC_015460.1|:c348631-348278 Gallibacterium anatis UMN179 chromosome, complete genome
ATGGAAAAAGATGAAACTATCCAATTCCTGCCTGAGCGTCTTAATCGTCAGCCTGTTGTGTTTAGAGGGA
TGACCATATCCGAATTACTCGTGGTGTTCGGTGTTGGTTTTGTCGTCGGATTGTTGTTGGGTATAGTCGC
AACAGTACTGATCGGTGATTGGGCTTTAATTCCAACTTGTGCACTTGGGCTTGCTTTTCTCTTCACCTTT
AAGGGCGGTAATGTGATCGCCCGTTTAAAACGGGGTAAGCCTGATACTTGGCTGCCTCGTTATCTTGAAC
AACGTTTCAAAACCAATCGTTTACTTATTGATAAAACGGATAACCGTAAGTATTGGTCTATTCGCCGTGG
TTAA
 Primer design