SecReT4
Protein ID: 332288425
T4SS name [ID]Tfc [680]
Gene symbol-
Locus tagUMN179_00343
StrainGallibacterium anatis UMN179
Repliconchromosome [GenBank: NC_015460] [Browse all T4SS(s) in this replicon]
Location [Strand]349277..349612 [-]
Productintegrative conjugative element protein
Component typeTfc9
UniProt IDF4HBM3
KEGG IDgan:UMN179_00343
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-23, Aligned region: 22..103
Protein Sequence: 111 a.a.     [Download]
>gi|332288425|ref|YP_004419277.1| integrative conjugative element protein [Gallibacterium anatis UMN179]
MCKKLKSISLVASLIAVFAFSSSALASEQSELAQAVKQLQAAKQSLQRAQAQARNIPTNRFYFDYRQAHA
DINVVAAGINHFLNNDRAQPRQPAQLQSLDGDYLQQNKTAR
 
Nucleotide Sequence: 336 bp     [Download]
>gi|332288085|ref|NC_015460.1|:c349612-349277 Gallibacterium anatis UMN179 chromosome, complete genome
ATGTGCAAGAAATTAAAATCAATCTCTCTCGTTGCAAGTTTAATTGCAGTGTTTGCTTTCAGTTCATCTG
CATTGGCAAGTGAACAAAGCGAGTTAGCACAAGCGGTTAAACAATTACAAGCTGCAAAACAATCATTACA
GCGTGCGCAAGCTCAAGCTCGTAATATTCCAACTAATCGATTCTATTTTGATTATCGGCAAGCTCATGCC
GATATCAATGTTGTCGCTGCTGGCATAAATCATTTTCTAAACAATGATCGCGCGCAACCGCGACAGCCGG
CGCAATTGCAGTCGTTGGATGGTGATTATCTTCAGCAAAACAAAACAGCAAGGTGA
 Primer design